Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 765593..766204 | Replicon | chromosome |
| Accession | NZ_CP116297 | ||
| Organism | Tenacibaculum finnmarkense strain LI C6 FM3-F | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | PJJ26_RS04075 | Protein ID | WP_232122568.1 |
| Coordinates | 765881..766204 (-) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | PJJ26_RS04070 | Protein ID | WP_101955994.1 |
| Coordinates | 765593..765877 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PJJ26_RS04050 (PJJ26_04050) | 762078..762797 | - | 720 | WP_101915816.1 | gliding motility-associated ABC transporter permease subunit GldF | - |
| PJJ26_RS04055 (PJJ26_04055) | 762797..763330 | - | 534 | WP_101955995.1 | GNAT family N-acetyltransferase | - |
| PJJ26_RS04060 (PJJ26_04060) | 763405..764268 | - | 864 | WP_101915814.1 | SAM-dependent chlorinase/fluorinase | - |
| PJJ26_RS04065 (PJJ26_04065) | 764403..765356 | + | 954 | WP_271412921.1 | PhoH family protein | - |
| PJJ26_RS04070 (PJJ26_04070) | 765593..765877 | - | 285 | WP_101955994.1 | putative addiction module antidote protein | Antitoxin |
| PJJ26_RS04075 (PJJ26_04075) | 765881..766204 | - | 324 | WP_232122568.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PJJ26_RS04080 (PJJ26_04080) | 766344..767816 | + | 1473 | WP_271412922.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
| PJJ26_RS04085 (PJJ26_04085) | 767946..768893 | + | 948 | WP_271412923.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
| PJJ26_RS04090 (PJJ26_04090) | 768886..769278 | + | 393 | WP_101915811.1 | glyoxalase | - |
| PJJ26_RS04095 (PJJ26_04095) | 769306..770494 | + | 1189 | Protein_648 | trans-2-enoyl-CoA reductase family protein | - |
| PJJ26_RS04100 (PJJ26_04100) | 770581..771051 | + | 471 | WP_271412924.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12733.03 Da Isoelectric Point: 10.4272
>T268574 WP_232122568.1 NZ_CP116297:c766204-765881 [Tenacibaculum finnmarkense]
MYPSRYSIMFFIEKTTEFDKWLKKLKDFKAKAKILFRIQKLESDEHFGDCKTVGDGIREMRINFAKGYRIYFKEKDGKVI
VLLIGGDKSTQQKDITKAKEIWKKLNK
MYPSRYSIMFFIEKTTEFDKWLKKLKDFKAKAKILFRIQKLESDEHFGDCKTVGDGIREMRINFAKGYRIYFKEKDGKVI
VLLIGGDKSTQQKDITKAKEIWKKLNK
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|