Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 765593..766204 | Replicon | chromosome |
Accession | NZ_CP116297 | ||
Organism | Tenacibaculum finnmarkense strain LI C6 FM3-F |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | PJJ26_RS04075 | Protein ID | WP_232122568.1 |
Coordinates | 765881..766204 (-) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PJJ26_RS04070 | Protein ID | WP_101955994.1 |
Coordinates | 765593..765877 (-) | Length | 95 a.a. |
Genomic Context
Location: 764403..765356 (954 bp)
Type: Others
Protein ID: WP_271412921.1
Type: Others
Protein ID: WP_271412921.1
Location: 766344..767816 (1473 bp)
Type: Others
Protein ID: WP_271412922.1
Type: Others
Protein ID: WP_271412922.1
Location: 767946..768893 (948 bp)
Type: Others
Protein ID: WP_271412923.1
Type: Others
Protein ID: WP_271412923.1
Location: 768886..769278 (393 bp)
Type: Others
Protein ID: WP_101915811.1
Type: Others
Protein ID: WP_101915811.1
Location: 769306..770494 (1189 bp)
Type: Others
Protein ID: Protein_648
Type: Others
Protein ID: Protein_648
Location: 770581..771051 (471 bp)
Type: Others
Protein ID: WP_271412924.1
Type: Others
Protein ID: WP_271412924.1
Location: 762078..762797 (720 bp)
Type: Others
Protein ID: WP_101915816.1
Type: Others
Protein ID: WP_101915816.1
Location: 762797..763330 (534 bp)
Type: Others
Protein ID: WP_101955995.1
Type: Others
Protein ID: WP_101955995.1
Location: 763405..764268 (864 bp)
Type: Others
Protein ID: WP_101915814.1
Type: Others
Protein ID: WP_101915814.1
Location: 765593..765877 (285 bp)
Type: Antitoxin
Protein ID: WP_101955994.1
Type: Antitoxin
Protein ID: WP_101955994.1
Location: 765881..766204 (324 bp)
Type: Toxin
Protein ID: WP_232122568.1
Type: Toxin
Protein ID: WP_232122568.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PJJ26_RS04050 (PJJ26_04050) | 762078..762797 | - | 720 | WP_101915816.1 | gliding motility-associated ABC transporter permease subunit GldF | - |
PJJ26_RS04055 (PJJ26_04055) | 762797..763330 | - | 534 | WP_101955995.1 | GNAT family N-acetyltransferase | - |
PJJ26_RS04060 (PJJ26_04060) | 763405..764268 | - | 864 | WP_101915814.1 | SAM-dependent chlorinase/fluorinase | - |
PJJ26_RS04065 (PJJ26_04065) | 764403..765356 | + | 954 | WP_271412921.1 | PhoH family protein | - |
PJJ26_RS04070 (PJJ26_04070) | 765593..765877 | - | 285 | WP_101955994.1 | putative addiction module antidote protein | Antitoxin |
PJJ26_RS04075 (PJJ26_04075) | 765881..766204 | - | 324 | WP_232122568.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PJJ26_RS04080 (PJJ26_04080) | 766344..767816 | + | 1473 | WP_271412922.1 | bifunctional UDP-sugar hydrolase/5'-nucleotidase | - |
PJJ26_RS04085 (PJJ26_04085) | 767946..768893 | + | 948 | WP_271412923.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
PJJ26_RS04090 (PJJ26_04090) | 768886..769278 | + | 393 | WP_101915811.1 | glyoxalase | - |
PJJ26_RS04095 (PJJ26_04095) | 769306..770494 | + | 1189 | Protein_648 | trans-2-enoyl-CoA reductase family protein | - |
PJJ26_RS04100 (PJJ26_04100) | 770581..771051 | + | 471 | WP_271412924.1 | hypothetical protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12733.03 Da Isoelectric Point: 10.4272
>T268574 WP_232122568.1 NZ_CP116297:c766204-765881 [Tenacibaculum finnmarkense]
MYPSRYSIMFFIEKTTEFDKWLKKLKDFKAKAKILFRIQKLESDEHFGDCKTVGDGIREMRINFAKGYRIYFKEKDGKVI
VLLIGGDKSTQQKDITKAKEIWKKLNK
MYPSRYSIMFFIEKTTEFDKWLKKLKDFKAKAKILFRIQKLESDEHFGDCKTVGDGIREMRINFAKGYRIYFKEKDGKVI
VLLIGGDKSTQQKDITKAKEIWKKLNK
Download Length: 324 bp