Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 185944..186464 | Replicon | plasmid pPSbnut |
| Accession | NZ_CP116286 | ||
| Organism | MAG: Pantoea stewartii isolate RON18713 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | - |
| Locus tag | LZT29_RS21065 | Protein ID | WP_054633990.1 |
| Coordinates | 185944..186243 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | H3RK39 |
| Locus tag | LZT29_RS21070 | Protein ID | WP_006121899.1 |
| Coordinates | 186246..186464 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LZT29_RS21050 (LZT29_04366) | 182679..183683 | + | 1005 | WP_054633987.1 | decarboxylating 6-phosphogluconate dehydrogenase | - |
| LZT29_RS21055 (LZT29_04367) | 183701..185071 | + | 1371 | WP_283788997.1 | glucose-6-phosphate dehydrogenase | - |
| LZT29_RS21060 (LZT29_04368) | 185089..185784 | + | 696 | WP_054633989.1 | ROK family protein | - |
| LZT29_RS21065 (LZT29_04369) | 185944..186243 | - | 300 | WP_054633990.1 | CcdB family protein | Toxin |
| LZT29_RS21070 (LZT29_04370) | 186246..186464 | - | 219 | WP_006121899.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
| LZT29_RS21075 (LZT29_04371) | 186977..187237 | + | 261 | WP_054633991.1 | hypothetical protein | - |
| LZT29_RS21080 (LZT29_04372) | 187438..187770 | - | 333 | WP_253274974.1 | ATP-binding protein | - |
| LZT29_RS21085 (LZT29_04373) | 188078..189415 | - | 1338 | WP_054633993.1 | pyrimidine utilization transport protein G | - |
| LZT29_RS21090 (LZT29_04374) | 189447..189989 | - | 543 | WP_039339420.1 | pyrimidine utilization flavin reductase protein F | - |
| LZT29_RS21095 (LZT29_04375) | 190019..190609 | - | 591 | WP_283789002.1 | malonic semialdehyde reductase | - |
| LZT29_RS21100 (LZT29_04376) | 190594..191433 | - | 840 | WP_283789004.1 | pyrimidine utilization protein D | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | fliC | 1..262265 | 262265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11008.69 Da Isoelectric Point: 7.0045
>T268573 WP_054633990.1 NZ_CP116286:c186243-185944 [Pantoea stewartii]
MQFDVYSHKNGKKYPYLVEIQSYLIDTPGRLMVAPLALSGEFVGSGELYPEVLVNGSKYRVVTTDIASVPVKALGDKVGD
VSQYEATIKNAIFRLFWGF
MQFDVYSHKNGKKYPYLVEIQSYLIDTPGRLMVAPLALSGEFVGSGELYPEVLVNGSKYRVVTTDIASVPVKALGDKVGD
VSQYEATIKNAIFRLFWGF
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|