Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 185944..186464 | Replicon | plasmid pPSbnut |
Accession | NZ_CP116286 | ||
Organism | MAG: Pantoea stewartii isolate RON18713 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | LZT29_RS21065 | Protein ID | WP_054633990.1 |
Coordinates | 185944..186243 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | H3RK39 |
Locus tag | LZT29_RS21070 | Protein ID | WP_006121899.1 |
Coordinates | 186246..186464 (-) | Length | 73 a.a. |
Genomic Context
Location: 182679..183683 (1005 bp)
Type: Others
Protein ID: WP_054633987.1
Type: Others
Protein ID: WP_054633987.1
Location: 183701..185071 (1371 bp)
Type: Others
Protein ID: WP_283788997.1
Type: Others
Protein ID: WP_283788997.1
Location: 185089..185784 (696 bp)
Type: Others
Protein ID: WP_054633989.1
Type: Others
Protein ID: WP_054633989.1
Location: 186977..187237 (261 bp)
Type: Others
Protein ID: WP_054633991.1
Type: Others
Protein ID: WP_054633991.1
Location: 185944..186243 (300 bp)
Type: Toxin
Protein ID: WP_054633990.1
Type: Toxin
Protein ID: WP_054633990.1
Location: 186246..186464 (219 bp)
Type: Antitoxin
Protein ID: WP_006121899.1
Type: Antitoxin
Protein ID: WP_006121899.1
Location: 187438..187770 (333 bp)
Type: Others
Protein ID: WP_253274974.1
Type: Others
Protein ID: WP_253274974.1
Location: 188078..189415 (1338 bp)
Type: Others
Protein ID: WP_054633993.1
Type: Others
Protein ID: WP_054633993.1
Location: 189447..189989 (543 bp)
Type: Others
Protein ID: WP_039339420.1
Type: Others
Protein ID: WP_039339420.1
Location: 190019..190609 (591 bp)
Type: Others
Protein ID: WP_283789002.1
Type: Others
Protein ID: WP_283789002.1
Location: 190594..191433 (840 bp)
Type: Others
Protein ID: WP_283789004.1
Type: Others
Protein ID: WP_283789004.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
LZT29_RS21050 (LZT29_04366) | 182679..183683 | + | 1005 | WP_054633987.1 | decarboxylating 6-phosphogluconate dehydrogenase | - |
LZT29_RS21055 (LZT29_04367) | 183701..185071 | + | 1371 | WP_283788997.1 | glucose-6-phosphate dehydrogenase | - |
LZT29_RS21060 (LZT29_04368) | 185089..185784 | + | 696 | WP_054633989.1 | ROK family protein | - |
LZT29_RS21065 (LZT29_04369) | 185944..186243 | - | 300 | WP_054633990.1 | CcdB family protein | Toxin |
LZT29_RS21070 (LZT29_04370) | 186246..186464 | - | 219 | WP_006121899.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
LZT29_RS21075 (LZT29_04371) | 186977..187237 | + | 261 | WP_054633991.1 | hypothetical protein | - |
LZT29_RS21080 (LZT29_04372) | 187438..187770 | - | 333 | WP_253274974.1 | ATP-binding protein | - |
LZT29_RS21085 (LZT29_04373) | 188078..189415 | - | 1338 | WP_054633993.1 | pyrimidine utilization transport protein G | - |
LZT29_RS21090 (LZT29_04374) | 189447..189989 | - | 543 | WP_039339420.1 | pyrimidine utilization flavin reductase protein F | - |
LZT29_RS21095 (LZT29_04375) | 190019..190609 | - | 591 | WP_283789002.1 | malonic semialdehyde reductase | - |
LZT29_RS21100 (LZT29_04376) | 190594..191433 | - | 840 | WP_283789004.1 | pyrimidine utilization protein D | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | fliC | 1..262265 | 262265 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11008.69 Da Isoelectric Point: 7.0045
>T268573 WP_054633990.1 NZ_CP116286:c186243-185944 [Pantoea stewartii]
MQFDVYSHKNGKKYPYLVEIQSYLIDTPGRLMVAPLALSGEFVGSGELYPEVLVNGSKYRVVTTDIASVPVKALGDKVGD
VSQYEATIKNAIFRLFWGF
MQFDVYSHKNGKKYPYLVEIQSYLIDTPGRLMVAPLALSGEFVGSGELYPEVLVNGSKYRVVTTDIASVPVKALGDKVGD
VSQYEATIKNAIFRLFWGF
Download Length: 300 bp
Antitoxin
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
No matching records found |
Antitoxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | H3RK39 |