Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 733721..734338 | Replicon | chromosome |
| Accession | NZ_CP116285 | ||
| Organism | MAG: Pantoea stewartii isolate RON18713 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H3R994 |
| Locus tag | LZT29_RS03580 | Protein ID | WP_006117940.1 |
| Coordinates | 734123..734338 (+) | Length | 72 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | LZT29_RS03575 | Protein ID | WP_054688064.1 |
| Coordinates | 733721..734098 (+) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LZT29_RS03545 (LZT29_00749) | 730013..730267 | + | 255 | WP_033738687.1 | type B 50S ribosomal protein L31 | - |
| LZT29_RS03550 (LZT29_00750) | 730279..730419 | + | 141 | WP_006117931.1 | type B 50S ribosomal protein L36 | - |
| LZT29_RS03555 (LZT29_00751) | 730477..731355 | - | 879 | WP_033738684.1 | metal ABC transporter substrate-binding protein | - |
| LZT29_RS03560 (LZT29_00752) | 731368..732207 | - | 840 | WP_006117933.1 | metal ABC transporter permease | - |
| LZT29_RS03565 (LZT29_00753) | 732204..732871 | - | 668 | Protein_692 | ATP-binding cassette domain-containing protein | - |
| LZT29_RS03570 (LZT29_00754) | 733221..733574 | + | 354 | WP_054688063.1 | hypothetical protein | - |
| LZT29_RS03575 (LZT29_00755) | 733721..734098 | + | 378 | WP_054688064.1 | Hha toxicity modulator TomB | Antitoxin |
| LZT29_RS03580 (LZT29_00756) | 734123..734338 | + | 216 | WP_006117940.1 | HHA domain-containing protein | Toxin |
| LZT29_RS03590 (LZT29_00757) | 734764..735078 | + | 315 | WP_054688065.1 | MGMT family protein | - |
| LZT29_RS03595 (LZT29_00758) | 735119..735676 | - | 558 | WP_054688066.1 | YbaY family lipoprotein | - |
| LZT29_RS03600 (LZT29_00759) | 735869..736732 | + | 864 | WP_283787663.1 | acyl-CoA thioesterase II | - |
| LZT29_RS03605 (LZT29_00760) | 736781..738067 | - | 1287 | WP_033738675.1 | ammonium transporter AmtB | - |
| LZT29_RS03610 (LZT29_00761) | 738101..738439 | - | 339 | WP_003850469.1 | P-II family nitrogen regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 72 a.a. Molecular weight: 8528.91 Da Isoelectric Point: 9.4825
>T268572 WP_006117940.1 NZ_CP116285:734123-734338 [Pantoea stewartii]
MNKTLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDDELAVFYSAADHRLAELTMNKLYDKVPVSVWKFVR
MNKTLTKTDYLMRLRRCRSIDTLERVIEKNKYELSDDELAVFYSAADHRLAELTMNKLYDKVPVSVWKFVR
Download Length: 216 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 14592.20 Da Isoelectric Point: 4.4699
>AT268572 WP_054688064.1 NZ_CP116285:733721-734098 [Pantoea stewartii]
MDEYSPKRHDIAQLKYVCESLFDAGMATLTDSHHGWVNDPTADGNLQLNDLIEHIASFTMNYKIKHAEDEALITQIDEYL
DDTFMLFSNYSVNTQDLQRWQRSAKRLFNLFQEECAYLQQPSHSL
MDEYSPKRHDIAQLKYVCESLFDAGMATLTDSHHGWVNDPTADGNLQLNDLIEHIASFTMNYKIKHAEDEALITQIDEYL
DDTFMLFSNYSVNTQDLQRWQRSAKRLFNLFQEECAYLQQPSHSL
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|