Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 106834..107474 Replicon plasmid pASal5_J228
Accession NZ_CP116267
Organism Aeromonas salmonicida subsp. salmonicida strain J228

Toxin (Protein)


Gene name vagD Uniprot ID A0A807Z4U5
Locus tag PI861_RS23025 Protein ID WP_005320982.1
Coordinates 106834..107247 (-) Length 138 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A807Z5T0
Locus tag PI861_RS23030 Protein ID WP_005320985.1
Coordinates 107244..107474 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PI861_RS22990 (PI861_22990) 102012..102164 - 153 WP_005322083.1 Hok/Gef family protein -
PI861_RS22995 (PI861_22995) 102701..103456 - 756 WP_005322068.1 IS21-like element ISAs29 family helper ATPase IstB -
PI861_RS23000 (PI861_23000) 103471..105012 - 1542 WP_005322071.1 IS21-like element ISAs29 family transposase -
PI861_RS23005 (PI861_23005) 105234..105443 - 210 Protein_117 helix-turn-helix domain-containing protein -
PI861_RS23010 (PI861_23010) 105549..105857 - 309 WP_005320974.1 hypothetical protein -
PI861_RS23015 (PI861_23015) 105879..106376 - 498 WP_017413137.1 hypothetical protein -
PI861_RS23020 (PI861_23020) 106406..106708 - 303 WP_237709758.1 hypothetical protein -
PI861_RS23025 (PI861_23025) 106834..107247 - 414 WP_005320982.1 PIN domain-containing protein Toxin
PI861_RS23030 (PI861_23030) 107244..107474 - 231 WP_005320985.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PI861_RS23035 (PI861_23035) 107543..107929 - 387 WP_005320988.1 hypothetical protein -
PI861_RS23040 (PI861_23040) 108961..109407 + 447 WP_043145058.1 DNA repair protein RadC -
PI861_RS23045 (PI861_23045) 109447..109809 + 363 WP_005321010.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid mcr-3.15 / mcr-3.1 ascU / ascT / ascS / ascR / ascQ / ascP / ascO / ascN / aopN / acr1 / acr2 / ascX / ascY / ascV / acrR / acrG / acrV / acrH / aopB / aopD / exsC / exsE / exsB / exsA / exsD / ascB / ascC / ascD / ascE / ascF / ascG / ascH / ascI / ascJ / ascK / ascL / ati1 / ati2 / aopH / sycH / aopO / ascU / ascT / ascS / ascR / ascQ / ascP / ascO / ascN / aopN / acr1 / acr2 / ascX / ascY / ascV / acrG / acrV 1..176655 176655


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-42)


Sequences

Toxin        


Download         Length: 138 a.a.        Molecular weight: 14935.23 Da        Isoelectric Point: 5.7146

>T268571 WP_005320982.1 NZ_CP116267:c107247-106834 [Aeromonas salmonicida subsp. salmonicida]
VKTFMLDTCICSFIMREMPQSVLERLGAEVASGNRIVISAITYAEMRYGQIGKKASPKLGPAIDEFVRRLDGILPWDAAT
VDQTLEVRQQLAALGTPIGNNDAAIAAHALTAGCVLVTNNTREFSRVAGLLYEDWVH

Download         Length: 414 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8699.88 Da        Isoelectric Point: 4.7419

>AT268571 WP_005320985.1 NZ_CP116267:c107474-107244 [Aeromonas salmonicida subsp. salmonicida]
MRTVSIFKNGKNQAVRLPKDMEFQGVNDLEIIKNGDTITLRPARPDWFSLAECQKVDADFLQERTDVISDEGRFAL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A807Z4U5

Antitoxin

Source ID Structure
AlphaFold DB A0A807Z5T0

References