Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 106834..107474 | Replicon | plasmid pASal5_J228 |
| Accession | NZ_CP116267 | ||
| Organism | Aeromonas salmonicida subsp. salmonicida strain J228 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | A0A807Z4U5 |
| Locus tag | PI861_RS23025 | Protein ID | WP_005320982.1 |
| Coordinates | 106834..107247 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A807Z5T0 |
| Locus tag | PI861_RS23030 | Protein ID | WP_005320985.1 |
| Coordinates | 107244..107474 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PI861_RS22990 (PI861_22990) | 102012..102164 | - | 153 | WP_005322083.1 | Hok/Gef family protein | - |
| PI861_RS22995 (PI861_22995) | 102701..103456 | - | 756 | WP_005322068.1 | IS21-like element ISAs29 family helper ATPase IstB | - |
| PI861_RS23000 (PI861_23000) | 103471..105012 | - | 1542 | WP_005322071.1 | IS21-like element ISAs29 family transposase | - |
| PI861_RS23005 (PI861_23005) | 105234..105443 | - | 210 | Protein_117 | helix-turn-helix domain-containing protein | - |
| PI861_RS23010 (PI861_23010) | 105549..105857 | - | 309 | WP_005320974.1 | hypothetical protein | - |
| PI861_RS23015 (PI861_23015) | 105879..106376 | - | 498 | WP_017413137.1 | hypothetical protein | - |
| PI861_RS23020 (PI861_23020) | 106406..106708 | - | 303 | WP_237709758.1 | hypothetical protein | - |
| PI861_RS23025 (PI861_23025) | 106834..107247 | - | 414 | WP_005320982.1 | PIN domain-containing protein | Toxin |
| PI861_RS23030 (PI861_23030) | 107244..107474 | - | 231 | WP_005320985.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PI861_RS23035 (PI861_23035) | 107543..107929 | - | 387 | WP_005320988.1 | hypothetical protein | - |
| PI861_RS23040 (PI861_23040) | 108961..109407 | + | 447 | WP_043145058.1 | DNA repair protein RadC | - |
| PI861_RS23045 (PI861_23045) | 109447..109809 | + | 363 | WP_005321010.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | mcr-3.15 / mcr-3.1 | ascU / ascT / ascS / ascR / ascQ / ascP / ascO / ascN / aopN / acr1 / acr2 / ascX / ascY / ascV / acrR / acrG / acrV / acrH / aopB / aopD / exsC / exsE / exsB / exsA / exsD / ascB / ascC / ascD / ascE / ascF / ascG / ascH / ascI / ascJ / ascK / ascL / ati1 / ati2 / aopH / sycH / aopO / ascU / ascT / ascS / ascR / ascQ / ascP / ascO / ascN / aopN / acr1 / acr2 / ascX / ascY / ascV / acrG / acrV | 1..176655 | 176655 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14935.23 Da Isoelectric Point: 5.7146
>T268571 WP_005320982.1 NZ_CP116267:c107247-106834 [Aeromonas salmonicida subsp. salmonicida]
VKTFMLDTCICSFIMREMPQSVLERLGAEVASGNRIVISAITYAEMRYGQIGKKASPKLGPAIDEFVRRLDGILPWDAAT
VDQTLEVRQQLAALGTPIGNNDAAIAAHALTAGCVLVTNNTREFSRVAGLLYEDWVH
VKTFMLDTCICSFIMREMPQSVLERLGAEVASGNRIVISAITYAEMRYGQIGKKASPKLGPAIDEFVRRLDGILPWDAAT
VDQTLEVRQQLAALGTPIGNNDAAIAAHALTAGCVLVTNNTREFSRVAGLLYEDWVH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A807Z4U5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A807Z5T0 |