Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 175..694 | Replicon | plasmid pASal1_J228 |
Accession | NZ_CP116264 | ||
Organism | Aeromonas salmonicida subsp. salmonicida strain J228 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q7X2F1 |
Locus tag | PI861_RS22275 | Protein ID | WP_005321942.1 |
Coordinates | 175..462 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q8GMP0 |
Locus tag | PI861_RS22280 | Protein ID | WP_011069626.1 |
Coordinates | 452..694 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PI861_RS22275 (PI861_22275) | 175..462 | - | 288 | WP_005321942.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PI861_RS22280 (PI861_22280) | 452..694 | - | 243 | WP_011069626.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PI861_RS22285 (PI861_22285) | 726..1058 | - | 333 | WP_005321955.1 | hypothetical protein | - |
PI861_RS22290 (PI861_22290) | 1175..1381 | - | 207 | WP_129712442.1 | hypothetical protein | - |
PI861_RS22295 (PI861_22295) | 1383..1670 | - | 288 | WP_005321949.1 | hypothetical protein | - |
PI861_RS22300 (PI861_22300) | 1770..2111 | - | 342 | WP_011116720.1 | hypothetical protein | - |
PI861_RS22305 (PI861_22305) | 2112..2645 | - | 534 | WP_011069625.1 | hypothetical protein | - |
PI861_RS22310 (PI861_22310) | 2683..3300 | - | 618 | Protein_7 | relaxase/mobilization nuclease domain-containing protein | - |
PI861_RS22315 (PI861_22315) | 3350..3760 | - | 411 | WP_011116719.1 | MobC family plasmid mobilization relaxosome protein | - |
PI861_RS22320 (PI861_22320) | 4433..5440 | - | 1008 | WP_005321944.1 | replication initiation protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..5468 | 5468 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11356.17 Da Isoelectric Point: 9.9149
>T268570 WP_005321942.1 NZ_CP116264:c462-175 [Aeromonas salmonicida subsp. salmonicida]
MTFELEFDPRAWKEWKKLGDTVRQQFKKKLAEVLERPRVEANRLHGLPDCYKIKLRGAGYRLVYQVQDDRVLVFVVAVGK
REREQVYLDAGYRLE
MTFELEFDPRAWKEWKKLGDTVRQQFKKKLAEVLERPRVEANRLHGLPDCYKIKLRGAGYRLVYQVQDDRVLVFVVAVGK
REREQVYLDAGYRLE
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151KDX2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q8GMP0 |