Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relE-pasA/RelE-HTH |
| Location | 3434..3911 | Replicon | plasmid pASal3_J225 |
| Accession | NZ_CP116262 | ||
| Organism | Aeromonas salmonicida subsp. salmonicida strain J225 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A8T8CMR8 |
| Locus tag | PI860_RS23310 | Protein ID | WP_073531821.1 |
| Coordinates | 3434..3703 (-) | Length | 90 a.a. |
Antitoxin (Protein)
| Gene name | pasA | Uniprot ID | Q7X2E4 |
| Locus tag | PI860_RS23315 | Protein ID | WP_005321784.1 |
| Coordinates | 3687..3911 (-) | Length | 75 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PI860_RS23290 (PI860_23305) | 75..485 | - | 411 | WP_005321773.1 | MobC family plasmid mobilization relaxosome protein | - |
| PI860_RS23295 (PI860_23310) | 696..1019 | + | 324 | WP_005321770.1 | hypothetical protein | - |
| PI860_RS23300 (PI860_23315) | 1134..2120 | - | 987 | WP_005321767.1 | replication initiation protein | - |
| PI860_RS23305 (PI860_23320) | 2696..3325 | - | 630 | WP_005321764.1 | hypothetical protein | - |
| PI860_RS23310 (PI860_23325) | 3434..3703 | - | 270 | WP_073531821.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PI860_RS23315 (PI860_23330) | 3687..3911 | - | 225 | WP_005321784.1 | TraY domain-containing protein | Antitoxin |
| PI860_RS23320 (PI860_23335) | 5693..6109 | - | 417 | WP_005321738.1 | MobC family plasmid mobilization relaxosome protein | - |
| PI860_RS23325 (PI860_23340) | 6321..6644 | + | 324 | WP_005321740.1 | hypothetical protein | - |
| PI860_RS23330 (PI860_23345) | 6758..7732 | - | 975 | WP_005321745.1 | replication initiation protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | aopP | 1..10346 | 10346 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 90 a.a. Molecular weight: 10358.02 Da Isoelectric Point: 10.3800
>T268569 WP_073531821.1 NZ_CP116262:c3703-3434 [Aeromonas salmonicida subsp. salmonicida]
MAWKVELTDTAKKQLARLDKTQSQRITKYLRRIMMLENPRDAGKALTGNLRTYWRYRVGDYRVVCDIRDNDLVIVAVIIG
HRSEVYGGS
MAWKVELTDTAKKQLARLDKTQSQRITKYLRRIMMLENPRDAGKALTGNLRTYWRYRVGDYRVVCDIRDNDLVIVAVIIG
HRSEVYGGS
Download Length: 270 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|