Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2232..2751 | Replicon | plasmid pASal1_J225 |
Accession | NZ_CP116260 | ||
Organism | Aeromonas salmonicida subsp. salmonicida strain J225 |
Toxin (Protein)
Gene name | relE | Uniprot ID | Q7X2F1 |
Locus tag | PI860_RS23210 | Protein ID | WP_005321942.1 |
Coordinates | 2232..2519 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | Q8GMP0 |
Locus tag | PI860_RS23215 | Protein ID | WP_011069626.1 |
Coordinates | 2509..2751 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PI860_RS23200 (PI860_23215) | 1..5449 | - | 5449 | WP_011116719.1 | MobC family plasmid mobilization relaxosome protein | - |
PI860_RS23205 (PI860_23220) | 1041..2048 | - | 1008 | WP_005321944.1 | replication initiation protein | - |
PI860_RS23210 (PI860_23225) | 2232..2519 | - | 288 | WP_005321942.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PI860_RS23215 (PI860_23230) | 2509..2751 | - | 243 | WP_011069626.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
PI860_RS23220 (PI860_23235) | 2783..3115 | - | 333 | WP_005321955.1 | hypothetical protein | - |
PI860_RS23225 (PI860_23240) | 3232..3438 | - | 207 | WP_129712442.1 | hypothetical protein | - |
PI860_RS23230 (PI860_23245) | 3440..3727 | - | 288 | WP_005321949.1 | hypothetical protein | - |
PI860_RS23235 (PI860_23250) | 3827..4168 | - | 342 | WP_011116720.1 | hypothetical protein | - |
PI860_RS23240 (PI860_23255) | 4169..4702 | - | 534 | WP_011069625.1 | hypothetical protein | - |
PI860_RS23245 (PI860_23260) | 4740..5357 | - | 618 | Protein_9 | relaxase/mobilization nuclease domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..5449 | 5449 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11356.17 Da Isoelectric Point: 9.9149
>T268568 WP_005321942.1 NZ_CP116260:c2519-2232 [Aeromonas salmonicida subsp. salmonicida]
MTFELEFDPRAWKEWKKLGDTVRQQFKKKLAEVLERPRVEANRLHGLPDCYKIKLRGAGYRLVYQVQDDRVLVFVVAVGK
REREQVYLDAGYRLE
MTFELEFDPRAWKEWKKLGDTVRQQFKKKLAEVLERPRVEANRLHGLPDCYKIKLRGAGYRLVYQVQDDRVLVFVVAVGK
REREQVYLDAGYRLE
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A151KDX2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q8GMP0 |