Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 16925..17568 Replicon plasmid pMCR10_120063
Accession NZ_CP116250
Organism Enterobacter roggenkampii strain 120063

Toxin (Protein)


Gene name vagD Uniprot ID A0A155IU92
Locus tag KK030_RS24635 Protein ID WP_000754567.1
Coordinates 16925..17341 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A155IUD1
Locus tag KK030_RS24640 Protein ID WP_023293777.1
Coordinates 17338..17568 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KK030_RS24605 (KK030_24555) 12111..12692 + 582 WP_032676110.1 TetR/AcrR family transcriptional regulator -
KK030_RS24610 (KK030_24560) 12697..13035 + 339 WP_000888080.1 carboxymuconolactone decarboxylase family protein -
KK030_RS24615 (KK030_24565) 13065..13394 - 330 WP_008502229.1 thioredoxin family protein -
KK030_RS24620 (KK030_24570) 13607..14713 + 1107 WP_006687059.1 alkene reductase -
KK030_RS24625 (KK030_24575) 14779..15480 + 702 WP_008502228.1 DsbA family oxidoreductase -
KK030_RS24630 (KK030_24580) 15606..16574 + 969 WP_271800746.1 IS5-like element IS903B family transposase -
KK030_RS24635 (KK030_24585) 16925..17341 - 417 WP_000754567.1 type II toxin-antitoxin system VapC family toxin Toxin
KK030_RS24640 (KK030_24590) 17338..17568 - 231 WP_023293777.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
KK030_RS24645 (KK030_24595) 17706..18260 + 555 WP_161646454.1 hypothetical protein -
KK030_RS24650 (KK030_24600) 18348..18419 - 72 Protein_24 hypothetical protein -
KK030_RS24655 (KK030_24605) 18549..19754 + 1206 WP_006797591.1 AAA family ATPase -
KK030_RS24660 (KK030_24610) 19754..20728 + 975 WP_000064119.1 ParB family protein -
KK030_RS24665 (KK030_24615) 20810..22081 - 1272 WP_032627083.1 Y-family DNA polymerase -
KK030_RS24670 (KK030_24620) 22081..22512 - 432 WP_006796638.1 translesion error-prone DNA polymerase V autoproteolytic subunit -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid mcr-10 - 1..195008 195008
- inside IScluster/Tn - - 2813..16574 13761


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15108.61 Da        Isoelectric Point: 8.5403

>T268564 WP_000754567.1 NZ_CP116250:c17341-16925 [Enterobacter roggenkampii]
MKKTWMLDTNICSFIMREQPAAVLKRLEQVVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNTREFERVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8706.73 Da        Isoelectric Point: 4.4299

>AT268564 WP_023293777.1 NZ_CP116250:c17568-17338 [Enterobacter roggenkampii]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAQREDVVSDEGRFDP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A155IU92

Antitoxin

Source ID Structure
AlphaFold DB A0A155IUD1

References