Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 4825..5561 | Replicon | plasmid pMCR10_120063 |
| Accession | NZ_CP116250 | ||
| Organism | Enterobacter roggenkampii strain 120063 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | KK030_RS24560 | Protein ID | WP_003026803.1 |
| Coordinates | 5079..5561 (+) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | KK030_RS24555 | Protein ID | WP_003026799.1 |
| Coordinates | 4825..5091 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KK030_RS24530 (KK030_24480) | 1..1011 | + | 1011 | WP_000200070.1 | RepB family plasmid replication initiator protein | - |
| KK030_RS24535 (KK030_24485) | 1709..2449 | - | 741 | WP_001515717.1 | tyrosine-type recombinase/integrase | - |
| KK030_RS24540 (KK030_24490) | 2813..3781 | - | 969 | WP_271800736.1 | IS5-like element IS903B family transposase | - |
| KK030_RS24545 (KK030_24495) | 3933..4136 | + | 204 | WP_004213596.1 | HHA domain-containing protein | - |
| KK030_RS24550 (KK030_24500) | 4150..4380 | + | 231 | WP_023307222.1 | hypothetical protein | - |
| KK030_RS24555 (KK030_24505) | 4825..5091 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| KK030_RS24560 (KK030_24510) | 5079..5561 | + | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| KK030_RS24565 (KK030_24515) | 5773..7116 | + | 1344 | WP_080339306.1 | ISNCY family transposase | - |
| KK030_RS24570 (KK030_24520) | 7187..8005 | - | 819 | WP_023307220.1 | abortive infection family protein | - |
| KK030_RS24575 (KK030_24525) | 8014..8442 | - | 429 | Protein_9 | recombinase family protein | - |
| KK030_RS24580 (KK030_24530) | 8402..9433 | - | 1032 | WP_001395480.1 | IS630-like element ISEc33 family transposase | - |
| KK030_RS24585 (KK030_24535) | 9535..9741 | - | 207 | Protein_11 | recombinase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | mcr-10 | - | 1..195008 | 195008 | |
| - | inside | IScluster/Tn | - | - | 2813..16574 | 13761 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T268563 WP_003026803.1 NZ_CP116250:5079-5561 [Enterobacter roggenkampii]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |