Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeV-yafW/CbtA-CbeA |
| Location | 4422953..4423746 | Replicon | chromosome |
| Accession | NZ_CP116249 | ||
| Organism | Enterobacter roggenkampii strain 120063 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1EZ92 |
| Locus tag | KK030_RS21920 | Protein ID | WP_000854726.1 |
| Coordinates | 4423369..4423746 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | S1EBQ7 |
| Locus tag | KK030_RS21915 | Protein ID | WP_001548930.1 |
| Coordinates | 4422953..4423279 (+) | Length | 109 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KK030_RS21865 (KK030_21820) | 4418257..4419078 | + | 822 | WP_214575091.1 | DUF932 domain-containing protein | - |
| KK030_RS21870 (KK030_21825) | 4419296..4419997 | + | 702 | WP_008324530.1 | WYL domain-containing protein | - |
| KK030_RS21875 (KK030_21830) | 4420044..4420280 | + | 237 | WP_001115854.1 | protein YpjK | - |
| KK030_RS21880 (KK030_21835) | 4420280..4420723 | + | 444 | WP_053263801.1 | lipoprotein YafY | - |
| KK030_RS21885 (KK030_21840) | 4420746..4421213 | + | 468 | WP_023305531.1 | protein YkfB | - |
| KK030_RS21890 (KK030_21845) | 4421290..4421544 | + | 255 | WP_101743273.1 | DUF905 domain-containing protein | - |
| KK030_RS21895 (KK030_21850) | 4421534..4421656 | + | 123 | WP_077760868.1 | DUF905 family protein | - |
| KK030_RS21900 (KK030_21855) | 4421754..4422212 | + | 459 | WP_000211838.1 | antirestriction protein | - |
| KK030_RS21905 (KK030_21860) | 4422228..4422704 | + | 477 | WP_001549015.1 | RadC family protein | - |
| KK030_RS21910 (KK030_21865) | 4422713..4422934 | + | 222 | WP_016239820.1 | DUF987 domain-containing protein | - |
| KK030_RS21915 (KK030_21870) | 4422953..4423279 | + | 327 | WP_001548930.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
| KK030_RS21920 (KK030_21875) | 4423369..4423746 | + | 378 | WP_000854726.1 | TA system toxin CbtA family protein | Toxin |
| KK030_RS21925 (KK030_21880) | 4423743..4424231 | + | 489 | WP_001547769.1 | DUF5983 family protein | - |
| KK030_RS21930 (KK030_21885) | 4424243..4424440 | + | 198 | WP_000839269.1 | DUF957 domain-containing protein | - |
| KK030_RS21935 (KK030_21890) | 4424525..4425367 | + | 843 | WP_001548928.1 | DUF4942 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14164.10 Da Isoelectric Point: 7.8045
>T268562 WP_000854726.1 NZ_CP116249:4423369-4423746 [Enterobacter roggenkampii]
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
MKTLPDTHVREASRCPSPVTIWQTLLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|