Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 4217663..4218239 | Replicon | chromosome |
| Accession | NZ_CP116249 | ||
| Organism | Enterobacter roggenkampii strain 120063 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | - |
| Locus tag | KK030_RS20885 | Protein ID | WP_214574428.1 |
| Coordinates | 4217952..4218239 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A156JBA1 |
| Locus tag | KK030_RS20880 | Protein ID | WP_023293359.1 |
| Coordinates | 4217663..4217965 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KK030_RS20855 (KK030_20810) | 4213770..4214315 | + | 546 | WP_008501313.1 | YfaZ family outer membrane protein | - |
| KK030_RS20860 (KK030_20815) | 4214315..4214635 | + | 321 | WP_008501314.1 | hypothetical protein | - |
| KK030_RS20865 (KK030_20820) | 4214681..4216051 | - | 1371 | WP_214574432.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
| KK030_RS20870 (KK030_20825) | 4216203..4216946 | + | 744 | WP_129343673.1 | AraC family transcriptional regulator | - |
| KK030_RS20875 (KK030_20830) | 4216994..4217632 | + | 639 | WP_214574430.1 | LysE family translocator | - |
| KK030_RS20880 (KK030_20835) | 4217663..4217965 | - | 303 | WP_023293359.1 | BrnA antitoxin family protein | Antitoxin |
| KK030_RS20885 (KK030_20840) | 4217952..4218239 | - | 288 | WP_214574428.1 | BrnT family toxin | Toxin |
| KK030_RS20890 (KK030_20845) | 4218394..4219665 | + | 1272 | WP_045353153.1 | DUF445 domain-containing protein | - |
| KK030_RS20895 (KK030_20850) | 4219662..4220738 | - | 1077 | WP_055321639.1 | DUF2955 domain-containing protein | - |
| KK030_RS20900 (KK030_20855) | 4220728..4221795 | - | 1068 | WP_139963628.1 | HlyD family secretion protein | - |
| KK030_RS20905 (KK030_20860) | 4221792..4222262 | - | 471 | WP_008501325.1 | MarR family transcriptional regulator | - |
| KK030_RS20910 (KK030_20865) | 4222408..4223103 | - | 696 | WP_214574426.1 | winged helix-turn-helix domain-containing protein | - |
| KK030_RS20915 (KK030_20870) | 4223096..4223212 | - | 117 | Protein_4091 | amino acid-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11291.85 Da Isoelectric Point: 9.4591
>T268561 WP_214574428.1 NZ_CP116249:c4218239-4217952 [Enterobacter roggenkampii]
MPMEYEWDNNKAKSNLQKHGIRFEDAVMVFDDPYHLSVQDRYENGKFRWQTIGLVQGLLVILVAHTVRFESGGEIIRIIS
ARKADRKERSRYEHR
MPMEYEWDNNKAKSNLQKHGIRFEDAVMVFDDPYHLSVQDRYENGKFRWQTIGLVQGLLVILVAHTVRFESGGEIIRIIS
ARKADRKERSRYEHR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|