Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 3869905..3870584 | Replicon | chromosome |
| Accession | NZ_CP116249 | ||
| Organism | Enterobacter roggenkampii strain 120063 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | KK030_RS19235 | Protein ID | WP_016246873.1 |
| Coordinates | 3870243..3870584 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | - |
| Locus tag | KK030_RS19230 | Protein ID | WP_113372912.1 |
| Coordinates | 3869905..3870222 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KK030_RS19190 (KK030_19150) | 3864925..3865668 | + | 744 | WP_214575118.1 | hypothetical protein | - |
| KK030_RS19200 (KK030_19160) | 3866569..3867429 | + | 861 | WP_214575113.1 | GTPase family protein | - |
| KK030_RS19205 (KK030_19165) | 3867518..3868339 | + | 822 | WP_113372767.1 | DUF932 domain-containing protein | - |
| KK030_RS19210 (KK030_19170) | 3868363..3868602 | + | 240 | WP_007869725.1 | DUF905 domain-containing protein | - |
| KK030_RS19215 (KK030_19175) | 3868706..3869164 | + | 459 | WP_113372854.1 | antirestriction protein | - |
| KK030_RS19220 (KK030_19180) | 3869180..3869656 | + | 477 | WP_000811693.1 | RadC family protein | - |
| KK030_RS19225 (KK030_19185) | 3869665..3869886 | + | 222 | WP_063841895.1 | DUF987 domain-containing protein | - |
| KK030_RS19230 (KK030_19190) | 3869905..3870222 | + | 318 | WP_113372912.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| KK030_RS19235 (KK030_19195) | 3870243..3870584 | + | 342 | WP_016246873.1 | TA system toxin CbtA family protein | Toxin |
| KK030_RS19245 (KK030_19205) | 3871153..3872406 | - | 1254 | WP_045354384.1 | glutamate-5-semialdehyde dehydrogenase | - |
| KK030_RS19250 (KK030_19210) | 3872418..3873521 | - | 1104 | WP_214574768.1 | glutamate 5-kinase | - |
| KK030_RS19255 (KK030_19215) | 3873826..3874878 | + | 1053 | WP_008501878.1 | phosphoporin PhoE | - |
| KK030_RS19260 (KK030_19220) | 3875015..3875416 | - | 402 | WP_008500249.1 | sigma factor-binding protein Crl | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3862348..3870584 | 8236 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12987.05 Da Isoelectric Point: 10.2764
>T268560 WP_016246873.1 NZ_CP116249:3870243-3870584 [Enterobacter roggenkampii]
MKTLPATTQRAAKPCLAPVAVWQMLLTRLLKQHYGLTLNDTPFSEERVIQEHIDAGITLADAVNFLVEKYELVRIDRKGF
NWQEQSPYLRAVDILRARQATGLLRQSRNNVVR
MKTLPATTQRAAKPCLAPVAVWQMLLTRLLKQHYGLTLNDTPFSEERVIQEHIDAGITLADAVNFLVEKYELVRIDRKGF
NWQEQSPYLRAVDILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|