Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3686130..3686750 | Replicon | chromosome |
| Accession | NZ_CP116249 | ||
| Organism | Enterobacter roggenkampii strain 120063 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A1H8SI38 |
| Locus tag | KK030_RS18390 | Protein ID | WP_008499287.1 |
| Coordinates | 3686532..3686750 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | V3PBI9 |
| Locus tag | KK030_RS18385 | Protein ID | WP_008499288.1 |
| Coordinates | 3686130..3686504 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KK030_RS18375 (KK030_18340) | 3681274..3684420 | + | 3147 | WP_008499289.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| KK030_RS18380 (KK030_18345) | 3684687..3685667 | + | 981 | WP_271775139.1 | IS5-like element ISKpn26 family transposase | - |
| KK030_RS18385 (KK030_18350) | 3686130..3686504 | + | 375 | WP_008499288.1 | Hha toxicity modulator TomB | Antitoxin |
| KK030_RS18390 (KK030_18355) | 3686532..3686750 | + | 219 | WP_008499287.1 | HHA domain-containing protein | Toxin |
| KK030_RS18395 (KK030_18360) | 3686957..3687508 | + | 552 | WP_214573598.1 | maltose O-acetyltransferase | - |
| KK030_RS18400 (KK030_18365) | 3687626..3688093 | + | 468 | WP_008499285.1 | YlaC family protein | - |
| KK030_RS18405 (KK030_18370) | 3688065..3689525 | - | 1461 | WP_059359545.1 | PLP-dependent aminotransferase family protein | - |
| KK030_RS18410 (KK030_18375) | 3689627..3690337 | + | 711 | WP_045352701.1 | GNAT family protein | - |
| KK030_RS18415 (KK030_18380) | 3690334..3690474 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| KK030_RS18420 (KK030_18385) | 3690477..3690737 | - | 261 | WP_006176933.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 3684687..3685667 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8612.00 Da Isoelectric Point: 8.9008
>T268559 WP_008499287.1 NZ_CP116249:3686532-3686750 [Enterobacter roggenkampii]
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
MSDKPLTKIDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14481.28 Da Isoelectric Point: 4.8886
>AT268559 WP_008499288.1 NZ_CP116249:3686130-3686504 [Enterobacter roggenkampii]
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1H8SI38 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V3PBI9 |