Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
| Location | 3006638..3007435 | Replicon | chromosome |
| Accession | NZ_CP116249 | ||
| Organism | Enterobacter roggenkampii strain 120063 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | - |
| Locus tag | KK030_RS14985 | Protein ID | WP_214574848.1 |
| Coordinates | 3006638..3007159 (-) | Length | 174 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | W7PG43 |
| Locus tag | KK030_RS14990 | Protein ID | WP_008499829.1 |
| Coordinates | 3007166..3007435 (-) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KK030_RS14955 (KK030_14925) | 3002221..3002910 | + | 690 | WP_214574849.1 | pyrimidine utilization protein B | - |
| KK030_RS14960 (KK030_14930) | 3002922..3003308 | + | 387 | WP_008499822.1 | pyrimidine utilization protein C | - |
| KK030_RS14965 (KK030_14935) | 3003316..3004116 | + | 801 | WP_021240807.1 | pyrimidine utilization protein D | - |
| KK030_RS14970 (KK030_14940) | 3004126..3004716 | + | 591 | WP_032651257.1 | malonic semialdehyde reductase | - |
| KK030_RS14975 (KK030_14945) | 3004726..3005220 | + | 495 | WP_023292823.1 | pyrimidine utilization flavin reductase protein F | - |
| KK030_RS14980 (KK030_14950) | 3005242..3006564 | + | 1323 | WP_008499826.1 | pyrimidine utilization transport protein G | - |
| KK030_RS14985 (KK030_14955) | 3006638..3007159 | - | 522 | WP_214574848.1 | GNAT family N-acetyltransferase | Toxin |
| KK030_RS14990 (KK030_14960) | 3007166..3007435 | - | 270 | WP_008499829.1 | DUF1778 domain-containing protein | Antitoxin |
| KK030_RS14995 (KK030_14965) | 3007497..3008414 | - | 918 | WP_025912980.1 | DMT family transporter | - |
| KK030_RS15000 (KK030_14970) | 3008533..3008703 | - | 171 | WP_013097201.1 | general stress protein | - |
| KK030_RS15005 (KK030_14975) | 3009095..3009691 | + | 597 | WP_008499831.1 | NAD(P)H:quinone oxidoreductase | - |
| KK030_RS15010 (KK030_14980) | 3009712..3009939 | + | 228 | WP_008499832.1 | YccJ family protein | - |
| KK030_RS15015 (KK030_14985) | 3010035..3010712 | - | 678 | Protein_2940 | contractile injection system protein, VgrG/Pvc8 family | - |
| KK030_RS15025 (KK030_14995) | 3011515..3012336 | + | 822 | Protein_2942 | magnesium transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19684.43 Da Isoelectric Point: 7.0497
>T268558 WP_214574848.1 NZ_CP116249:c3007159-3006638 [Enterobacter roggenkampii]
VDNLTIEMFSEGKDYDFRDFDCGEPSLNVFLTEHLVRQHNGRILRGYLLKDRDGPRVLGYYTLSGSCFEKAMLPSKTQQR
RIPYSNVPSVALGRLAIHKDLQGLEWGTTLVTHAMRVVYLASQAVGVHGIFVDALNDQAKQFYLKQGFIPLTDENSHSLF
FPTKSIERLFEQA
VDNLTIEMFSEGKDYDFRDFDCGEPSLNVFLTEHLVRQHNGRILRGYLLKDRDGPRVLGYYTLSGSCFEKAMLPSKTQQR
RIPYSNVPSVALGRLAIHKDLQGLEWGTTLVTHAMRVVYLASQAVGVHGIFVDALNDQAKQFYLKQGFIPLTDENSHSLF
FPTKSIERLFEQA
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|