Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 1887037..1887592 | Replicon | chromosome |
| Accession | NZ_CP116249 | ||
| Organism | Enterobacter roggenkampii strain 120063 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A839BSP9 |
| Locus tag | KK030_RS09520 | Protein ID | WP_071881499.1 |
| Coordinates | 1887037..1887303 (+) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A839BUZ1 |
| Locus tag | KK030_RS09525 | Protein ID | WP_038416295.1 |
| Coordinates | 1887290..1887592 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KK030_RS09500 (KK030_09490) | 1882511..1885795 | + | 3285 | WP_063160719.1 | type I restriction endonuclease subunit R | - |
| KK030_RS09505 (KK030_09495) | 1885792..1886547 | + | 756 | WP_063135765.1 | SprT family zinc-dependent metalloprotease | - |
| KK030_RS09510 (KK030_09500) | 1886634..1886708 | + | 75 | Protein_1848 | hypothetical protein | - |
| KK030_RS09515 (KK030_09505) | 1886681..1886992 | - | 312 | Protein_1849 | IS5/IS1182 family transposase | - |
| KK030_RS09520 (KK030_09510) | 1887037..1887303 | + | 267 | WP_071881499.1 | BrnT family toxin | Toxin |
| KK030_RS09525 (KK030_09515) | 1887290..1887592 | + | 303 | WP_038416295.1 | BrnA antitoxin family protein | Antitoxin |
| KK030_RS09530 (KK030_09520) | 1887713..1889056 | - | 1344 | WP_038416294.1 | APC family permease | - |
| KK030_RS09535 (KK030_09525) | 1889053..1889964 | - | 912 | WP_038416293.1 | acetamidase/formamidase family protein | - |
| KK030_RS09540 (KK030_09530) | 1890263..1891000 | - | 738 | Protein_1854 | IS5-like element IS5 family transposase | - |
| KK030_RS09545 (KK030_09535) | 1891038..1891724 | + | 687 | Protein_1855 | IS3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | IScluster/Tn | - | - | 1886594..1899574 | 12980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10474.91 Da Isoelectric Point: 10.0832
>T268553 WP_071881499.1 NZ_CP116249:1887037-1887303 [Enterobacter roggenkampii]
IRDLFAPSLRKHGIRFEEAVLVFDDPRHLSRQDRYENGEYRWQTLSLVHRIIVIMVAHSVRFESGTEVIRIISARKADSK
ERNRYEHG
IRDLFAPSLRKHGIRFEEAVLVFDDPRHLSRQDRYENGEYRWQTLSLVHRIIVIMVAHSVRFESGTEVIRIISARKADSK
ERNRYEHG
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A839BSP9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A839BUZ1 |