Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | pemIK/PRK09812-MazE |
| Location | 1713776..1714366 | Replicon | chromosome |
| Accession | NZ_CP116249 | ||
| Organism | Enterobacter roggenkampii strain 120063 | ||
Toxin (Protein)
| Gene name | pemK | Uniprot ID | - |
| Locus tag | KK030_RS08415 | Protein ID | WP_094943135.1 |
| Coordinates | 1714034..1714366 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | - |
| Locus tag | KK030_RS08410 | Protein ID | WP_094919038.1 |
| Coordinates | 1713776..1714033 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KK030_RS08395 (KK030_08385) | 1709360..1709746 | + | 387 | Protein_1632 | MBL fold metallo-hydrolase | - |
| KK030_RS08400 (KK030_08390) | 1709817..1710514 | + | 698 | Protein_1633 | IS1 family transposase | - |
| KK030_RS08405 (KK030_08395) | 1710525..1713104 | - | 2580 | WP_250902612.1 | hypothetical protein | - |
| KK030_RS08410 (KK030_08400) | 1713776..1714033 | + | 258 | WP_094919038.1 | antitoxin | Antitoxin |
| KK030_RS08415 (KK030_08405) | 1714034..1714366 | + | 333 | WP_094943135.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| KK030_RS08425 (KK030_08415) | 1714661..1716850 | - | 2190 | WP_008499481.1 | TonB-dependent siderophore receptor | - |
| KK030_RS08430 (KK030_08420) | 1716877..1718202 | - | 1326 | WP_032675143.1 | SidA/IucD/PvdA family monooxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1699137..1714366 | 15229 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11816.70 Da Isoelectric Point: 10.2965
>T268552 WP_094943135.1 NZ_CP116249:1714034-1714366 [Enterobacter roggenkampii]
MERGEIWLVSLDPSAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEGAGTKTMGVIRCDQPRTI
DMAARNGMRLERIPDAVVNEVLARLDAILS
MERGEIWLVSLDPSAGHEQSGKRPVLIVSKASFNKLTRLPVVVPVTSGGNFARTAGFTVSLEGAGTKTMGVIRCDQPRTI
DMAARNGMRLERIPDAVVNEVLARLDAILS
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|