Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ypjF-yeeU/CbtA-CbeA |
| Location | 1017890..1018623 | Replicon | chromosome |
| Accession | NZ_CP116249 | ||
| Organism | Enterobacter roggenkampii strain 120063 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | - |
| Locus tag | KK030_RS05010 | Protein ID | WP_078309458.1 |
| Coordinates | 1017890..1018219 (-) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | KK030_RS05015 | Protein ID | WP_078309456.1 |
| Coordinates | 1018258..1018623 (-) | Length | 122 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KK030_RS04990 (KK030_04985) | 1013852..1014457 | + | 606 | WP_008502560.1 | ankyrin repeat domain-containing protein | - |
| KK030_RS04995 (KK030_04990) | 1014606..1015586 | - | 981 | WP_271798840.1 | IS5-like element ISKpn26 family transposase | - |
| KK030_RS05000 (KK030_04995) | 1015739..1016515 | + | 777 | WP_111967713.1 | isocitrate lyase/phosphoenolpyruvate mutase family protein | - |
| KK030_RS05005 (KK030_05000) | 1016499..1017545 | + | 1047 | WP_214574530.1 | methylated-DNA--[protein]-cysteine S-methyltransferase | - |
| KK030_RS05010 (KK030_05005) | 1017890..1018219 | - | 330 | WP_078309458.1 | TA system toxin CbtA family protein | Toxin |
| KK030_RS05015 (KK030_05010) | 1018258..1018623 | - | 366 | WP_078309456.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| KK030_RS05020 (KK030_05015) | 1018649..1018832 | - | 184 | Protein_973 | DUF987 family protein | - |
| KK030_RS05025 (KK030_05020) | 1018829..1019371 | - | 543 | WP_214574529.1 | DNA repair protein RadC | - |
| KK030_RS05030 (KK030_05025) | 1019384..1019827 | - | 444 | WP_078309452.1 | antirestriction protein | - |
| KK030_RS05035 (KK030_05030) | 1019858..1020679 | - | 822 | WP_078309451.1 | DUF932 domain-containing protein | - |
| KK030_RS05040 (KK030_05035) | 1020771..1021112 | - | 342 | WP_078309449.1 | hypothetical protein | - |
| KK030_RS05045 (KK030_05040) | 1021147..1021611 | - | 465 | WP_078309448.1 | hypothetical protein | - |
| KK030_RS05050 (KK030_05045) | 1021737..1021895 | - | 159 | WP_101706469.1 | hypothetical protein | - |
| KK030_RS05055 (KK030_05050) | 1022108..1022995 | - | 888 | WP_078309444.1 | 50S ribosome-binding GTPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 1003418..1021895 | 18477 | |
| - | flank | IS/Tn | - | - | 1014606..1015586 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12303.17 Da Isoelectric Point: 8.5043
>T268551 WP_078309458.1 NZ_CP116249:c1018219-1017890 [Enterobacter roggenkampii]
MQIISSAPTRAAPLSLSPVEIWQRLLTHLLSQHYGLTLNDTPFSYETTIREHIDAGVSLSDAVNFLVEKYGLVRIDRKGF
SWQEQTPYISVVDILMARRSTGLLKTTVK
MQIISSAPTRAAPLSLSPVEIWQRLLTHLLSQHYGLTLNDTPFSYETTIREHIDAGVSLSDAVNFLVEKYGLVRIDRKGF
SWQEQTPYISVVDILMARRSTGLLKTTVK
Download Length: 330 bp
Antitoxin
Download Length: 122 a.a. Molecular weight: 13427.12 Da Isoelectric Point: 5.4451
>AT268551 WP_078309456.1 NZ_CP116249:c1018623-1018258 [Enterobacter roggenkampii]
MNNHSESGTRPENSAIQQWGLKRAITPCFGARLVQEGNRLHYLADRAGFSGAFTDDVAMHLDQAFPLMMKQLELMLTSGE
LNPSHPHCVTLYHNGLTCEADTLGSCGYVYIAIYPEQTEPQ
MNNHSESGTRPENSAIQQWGLKRAITPCFGARLVQEGNRLHYLADRAGFSGAFTDDVAMHLDQAFPLMMKQLELMLTSGE
LNPSHPHCVTLYHNGLTCEADTLGSCGYVYIAIYPEQTEPQ
Download Length: 366 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|