Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 817889..818546 | Replicon | chromosome |
| Accession | NZ_CP116249 | ||
| Organism | Enterobacter roggenkampii strain 120063 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A1H8U0Q4 |
| Locus tag | KK030_RS04030 | Protein ID | WP_021242050.1 |
| Coordinates | 818136..818546 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | W7NX65 |
| Locus tag | KK030_RS04025 | Protein ID | WP_006178375.1 |
| Coordinates | 817889..818155 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KK030_RS04005 (KK030_04000) | 813323..814756 | - | 1434 | WP_023294510.1 | 6-phospho-beta-glucosidase BglA | - |
| KK030_RS04010 (KK030_04005) | 814873..815604 | - | 732 | WP_008499714.1 | MurR/RpiR family transcriptional regulator | - |
| KK030_RS04015 (KK030_04010) | 815870..816529 | + | 660 | WP_021242052.1 | hemolysin III family protein | - |
| KK030_RS04020 (KK030_04015) | 816614..817594 | - | 981 | WP_214574742.1 | tRNA-modifying protein YgfZ | - |
| KK030_RS04025 (KK030_04020) | 817889..818155 | + | 267 | WP_006178375.1 | FAD assembly factor SdhE | Antitoxin |
| KK030_RS04030 (KK030_04025) | 818136..818546 | + | 411 | WP_021242050.1 | protein YgfX | Toxin |
| KK030_RS04035 (KK030_04030) | 818553..819074 | - | 522 | WP_008499710.1 | flavodoxin FldB | - |
| KK030_RS04040 (KK030_04035) | 819176..820072 | + | 897 | WP_214574741.1 | site-specific tyrosine recombinase XerD | - |
| KK030_RS04045 (KK030_04040) | 820101..820814 | + | 714 | WP_214574740.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| KK030_RS04050 (KK030_04045) | 820820..822553 | + | 1734 | WP_214574739.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16097.08 Da Isoelectric Point: 10.9468
>T268550 WP_021242050.1 NZ_CP116249:818136-818546 [Enterobacter roggenkampii]
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
VVLWQSDLRVSWRSQWMSLLLHGLVAAFVLLMPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWDILGMPWMLNCGMMLRLRKVDGGRCQHLWLAADSMDAAEWRDLRRMLLQQTTQG
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1H8U0Q4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | W7NX65 |