Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 240589..241185 | Replicon | chromosome |
| Accession | NZ_CP116249 | ||
| Organism | Enterobacter roggenkampii strain 120063 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | KK030_RS01155 | Protein ID | WP_059363955.1 |
| Coordinates | 240883..241185 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | W7P674 |
| Locus tag | KK030_RS01150 | Protein ID | WP_021242718.1 |
| Coordinates | 240589..240876 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KK030_RS01145 (KK030_01145) | 238961..240592 | + | 1632 | WP_214573511.1 | Na/Pi cotransporter family protein | - |
| KK030_RS01150 (KK030_01150) | 240589..240876 | - | 288 | WP_021242718.1 | putative addiction module antidote protein | Antitoxin |
| KK030_RS01155 (KK030_01155) | 240883..241185 | - | 303 | WP_059363955.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| KK030_RS01160 (KK030_01160) | 241383..242255 | + | 873 | WP_008503414.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
| KK030_RS01165 (KK030_01165) | 242256..242528 | - | 273 | WP_059360216.1 | DUF3811 domain-containing protein | - |
| KK030_RS01170 (KK030_01170) | 242579..243523 | - | 945 | WP_023293551.1 | ketopantoate/pantoate/pantothenate transporter PanS | - |
| KK030_RS01175 (KK030_01175) | 243629..245203 | - | 1575 | WP_214573510.1 | RNA repair transcriptional activator RtcR | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11360.10 Da Isoelectric Point: 10.1771
>T268548 WP_059363955.1 NZ_CP116249:c241185-240883 [Enterobacter roggenkampii]
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDVKPVGEGISELRIHFGPGYRIYFKDQGNYIIVLLCGGDKS
SQARDILMAKMLSNVSQSQE
MKEIVQTESFRRWEQNLKDRRAKTIIASRLFRLANGLAGDVKPVGEGISELRIHFGPGYRIYFKDQGNYIIVLLCGGDKS
SQARDILMAKMLSNVSQSQE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|