Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | phd-doc/Doc-Phd |
Location | 82354..82955 | Replicon | plasmid unnamed4 |
Accession | NZ_CP116245 | ||
Organism | Escherichia coli strain 7.1994/NIST0056 |
Toxin (Protein)
Gene name | doc | Uniprot ID | U9ZW91 |
Locus tag | PH192_RS25160 | Protein ID | WP_001216033.1 |
Coordinates | 82575..82955 (+) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | phd | Uniprot ID | U9YQH9 |
Locus tag | PH192_RS25155 | Protein ID | WP_001190712.1 |
Coordinates | 82354..82575 (+) | Length | 74 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PH192_RS25140 (PH192_25135) | 78269..79459 | - | 1191 | WP_097331719.1 | anticodon nuclease | - |
PH192_RS25145 (PH192_25140) | 79461..80618 | - | 1158 | WP_097331718.1 | restriction endonuclease subunit S | - |
PH192_RS25150 (PH192_25145) | 80615..82171 | - | 1557 | WP_097331735.1 | type I restriction-modification system subunit M | - |
PH192_RS25155 (PH192_25150) | 82354..82575 | + | 222 | WP_001190712.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PH192_RS25160 (PH192_25155) | 82575..82955 | + | 381 | WP_001216033.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
PH192_RS25165 (PH192_25160) | 82960..83139 | + | 180 | WP_001339207.1 | hypothetical protein | - |
PH192_RS25170 (PH192_25165) | 83167..84210 | + | 1044 | WP_063100003.1 | DUF968 domain-containing protein | - |
PH192_RS25175 (PH192_25170) | 84299..84751 | + | 453 | WP_001326849.1 | late promoter-activating protein | - |
PH192_RS25180 (PH192_25175) | 84837..86030 | + | 1194 | WP_032167084.1 | terminase | - |
PH192_RS25185 (PH192_25180) | 86030..87514 | + | 1485 | WP_000124159.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..93185 | 93185 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13571.31 Da Isoelectric Point: 5.6343
>T268544 WP_001216033.1 NZ_CP116245:82575-82955 [Escherichia coli]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVAATLRRLYGSAE
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVAATLRRLYGSAE
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | U9ZW91 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CJB6 |