Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 109795..110420 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP116243 | ||
| Organism | Escherichia coli strain 7.1994/NIST0056 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PH192_RS24390 | Protein ID | WP_000911333.1 |
| Coordinates | 110022..110420 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | V0VCB2 |
| Locus tag | PH192_RS24385 | Protein ID | WP_000450520.1 |
| Coordinates | 109795..110022 (+) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PH192_RS24380 (109153) | 109153..109713 | - | 561 | Protein_107 | conjugative relaxase | - |
| PH192_RS24385 (109795) | 109795..110022 | + | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
| PH192_RS24390 (110022) | 110022..110420 | + | 399 | WP_000911333.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| PH192_RS24395 (110429) | 110429..112582 | - | 2154 | WP_000009325.1 | type IV conjugative transfer system coupling protein TraD | - |
| PH192_RS24400 (112835) | 112835..113566 | - | 732 | WP_000850422.1 | conjugal transfer complement resistance protein TraT | - |
| PH192_RS24405 (113580) | 113580..114089 | - | 510 | WP_000628107.1 | conjugal transfer entry exclusion protein TraS | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sitABCD | iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat | 1..148536 | 148536 | |
| - | flank | IS/Tn | - | - | 108398..108901 | 503 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14919.19 Da Isoelectric Point: 7.8605
>T268540 WP_000911333.1 NZ_CP116243:110022-110420 [Escherichia coli]
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTMKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|