Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 93760..94295 Replicon plasmid unnamed2
Accession NZ_CP116243
Organism Escherichia coli strain 7.1994/NIST0056

Toxin (Protein)


Gene name relE Uniprot ID Q3YTD6
Locus tag PH192_RS24285 Protein ID WP_000222766.1
Coordinates 93760..94047 (-) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0VIP2
Locus tag PH192_RS24290 Protein ID WP_001132900.1
Coordinates 94044..94295 (-) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PH192_RS24280 (92279) 92279..93491 + 1213 Protein_87 IS3 family transposase -
PH192_RS24285 (93760) 93760..94047 - 288 WP_000222766.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PH192_RS24290 (94044) 94044..94295 - 252 WP_001132900.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PH192_RS24295 (95258) 95258..96115 - 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
PH192_RS24300 (96108) 96108..96590 - 483 WP_001273588.1 hypothetical protein -
PH192_RS24305 (96583) 96583..96630 - 48 WP_229471593.1 hypothetical protein -
PH192_RS24310 (96621) 96621..96872 + 252 WP_223195197.1 replication protein RepA -
PH192_RS24315 (96889) 96889..97146 - 258 WP_000083845.1 replication regulatory protein RepA -
PH192_RS24320 (97430) 97430..97579 - 150 WP_001312851.1 Hok/Gef family protein -
- (97623) 97623..97684 + 62 NuclAT_1 - -
- (97623) 97623..97684 + 62 NuclAT_1 - -
- (97623) 97623..97684 + 62 NuclAT_1 - -
- (97623) 97623..97684 + 62 NuclAT_1 - -
PH192_RS24325 (97940) 97940..98014 - 75 Protein_96 endonuclease -
PH192_RS24330 (98260) 98260..98472 - 213 WP_001299730.1 ANR family transcriptional regulator -
PH192_RS24335 (98549) 98549..99212 + 664 Protein_98 IS66-like element accessory protein TnpA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat 1..148536 148536


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-83)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 11147.23 Da        Isoelectric Point: 10.5832

>T268535 WP_000222766.1 NZ_CP116243:c94047-93760 [Escherichia coli]
MTYTVKFRDDALKEWLKLDKTIQQQFVKKLKKCSENPHIPSAKLRGLKDCYKIKLRASGFRLVYQVIDDMLIIAVVAVGK
RERSNVYNLASERMR

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9211.41 Da        Isoelectric Point: 4.0780

>AT268535 WP_001132900.1 NZ_CP116243:c94295-94044 [Escherichia coli]
MPNIILSDTSASVSELKKNPMATVSAGDGYPVAILNRNQPAFYCVPAELYERMLDALDDQELVKLVTERSNQPLHDVDLD
SYL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CDZ2

Antitoxin

Source ID Structure
AlphaFold DB V0VIP2

References