Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 83753..84396 Replicon plasmid unnamed2
Accession NZ_CP116243
Organism Escherichia coli strain 7.1994/NIST0056

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag PH192_RS24255 Protein ID WP_001034044.1
Coordinates 83980..84396 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag PH192_RS24250 Protein ID WP_001261286.1
Coordinates 83753..83983 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PH192_RS24215 (78926) 78926..79093 + 168 Protein_74 colicin-B -
PH192_RS24220 (79111) 79111..79638 - 528 WP_000203272.1 colicin B immunity protein -
PH192_RS24225 (79882) 79882..80697 + 816 WP_001312845.1 lipid II-degrading bacteriocin colicin M -
PH192_RS24230 (80747) 80747..81100 - 354 WP_000864812.1 colicin M immunity protein -
PH192_RS24235 (81278) 81278..82069 - 792 WP_000016494.1 site-specific integrase -
PH192_RS24240 (82066) 82066..82755 - 690 WP_000796229.1 hypothetical protein -
PH192_RS24245 (82799) 82799..83149 - 351 WP_000493379.1 hypothetical protein -
PH192_RS24250 (83753) 83753..83983 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PH192_RS24255 (83980) 83980..84396 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
PH192_RS24260 (84471) 84471..86036 + 1566 WP_001128474.1 AAA family ATPase -
PH192_RS24265 (86021) 86021..87043 + 1023 WP_000361402.1 helicase UvrD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sitABCD iutA / iucD / iucC / iucB / iucA / iroB / iroC / iroD / iroE / iroN / vat 1..148536 148536


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T268534 WP_001034044.1 NZ_CP116243:83980-84396 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT268534 WP_001261286.1 NZ_CP116243:83753-83983 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References