Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 76881..77428 Replicon plasmid unnamed1
Accession NZ_CP116242
Organism Escherichia coli strain 7.1994/NIST0056

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag PH192_RS23605 Protein ID WP_001384452.1
Coordinates 76881..77159 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID K4JYR0
Locus tag PH192_RS23610 Protein ID WP_000079928.1
Coordinates 77159..77428 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PH192_RS23570 (71892) 71892..72134 + 243 WP_000844627.1 transposase -
PH192_RS23575 (72166) 72166..72816 - 651 WP_000164043.1 tetracycline resistance transcriptional repressor TetR(A) -
PH192_RS23580 (72922) 72922..74121 + 1200 WP_000804064.1 tetracycline efflux MFS transporter Tet(A) -
PH192_RS23585 (74153) 74153..75013 - 861 WP_000493383.1 EamA family transporter -
PH192_RS23590 (75022) 75022..75636 - 615 Protein_85 helix-turn-helix domain-containing protein -
PH192_RS23595 (75631) 75631..75756 + 126 Protein_86 MerR family transcriptional regulator -
PH192_RS23600 (75993) 75993..76841 - 849 WP_001057996.1 3'-5' exonuclease -
PH192_RS23605 (76881) 76881..77159 - 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
PH192_RS23610 (77159) 77159..77428 - 270 WP_000079928.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
PH192_RS23615 (77483) 77483..77641 - 159 WP_000841008.1 hypothetical protein -
PH192_RS23620 (78337) 78337..79368 - 1032 WP_000907875.1 plasmid replication initiator RepA -
PH192_RS23625 (80374) 80374..80604 + 231 WP_228772074.1 ash family protein -
PH192_RS23630 (80522) 80522..80809 + 288 WP_000074849.1 conjugal transfer protein TraA -
PH192_RS23635 (81251) 81251..81784 + 534 WP_001303319.1 transcription termination/antitermination NusG family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid ant(3'')-Ia / aac(3)-VIa / qacE / sul1 / tet(A) - 1..122629 122629


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T268532 WP_001384452.1 NZ_CP116242:c77159-76881 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10175.50 Da        Isoelectric Point: 7.3210

>AT268532 WP_000079928.1 NZ_CP116242:c77428-77159 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVAAGRQQLEHGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A5W2J4D0

References