Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 4464277..4464902 | Replicon | chromosome |
Accession | NZ_CP116241 | ||
Organism | Escherichia coli strain 7.1994/NIST0056 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | U9YZ02 |
Locus tag | PH192_RS21625 | Protein ID | WP_000911329.1 |
Coordinates | 4464504..4464902 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | PH192_RS21620 | Protein ID | WP_000450524.1 |
Coordinates | 4464277..4464504 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PH192_RS21595 (4460079) | 4460079..4460549 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
PH192_RS21600 (4460549) | 4460549..4461121 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
PH192_RS21605 (4461267) | 4461267..4462145 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
PH192_RS21610 (4462162) | 4462162..4463196 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
PH192_RS21615 (4463409) | 4463409..4464122 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
PH192_RS21620 (4464277) | 4464277..4464504 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
PH192_RS21625 (4464504) | 4464504..4464902 | + | 399 | WP_000911329.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PH192_RS21630 (4465049) | 4465049..4465912 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
PH192_RS21635 (4465927) | 4465927..4467942 | + | 2016 | WP_028985187.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
PH192_RS21640 (4468016) | 4468016..4468714 | + | 699 | WP_000679812.1 | esterase | - |
PH192_RS21645 (4468824) | 4468824..4469024 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14924.23 Da Isoelectric Point: 8.5325
>T268527 WP_000911329.1 NZ_CP116241:4464504-4464902 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLEVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XW84 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |