Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 4166982..4167565 | Replicon | chromosome |
| Accession | NZ_CP116241 | ||
| Organism | Escherichia coli strain 7.1994/NIST0056 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | U9XFN8 |
| Locus tag | PH192_RS20190 | Protein ID | WP_000254745.1 |
| Coordinates | 4167230..4167565 (+) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A2J1DJJ7 |
| Locus tag | PH192_RS20185 | Protein ID | WP_000581939.1 |
| Coordinates | 4166982..4167230 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PH192_RS20175 (4163321) | 4163321..4164622 | + | 1302 | WP_000046790.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
| PH192_RS20180 (4164670) | 4164670..4166904 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
| PH192_RS20185 (4166982) | 4166982..4167230 | + | 249 | WP_000581939.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
| PH192_RS20190 (4167230) | 4167230..4167565 | + | 336 | WP_000254745.1 | endoribonuclease MazF | Toxin |
| PH192_RS20195 (4167636) | 4167636..4168427 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
| PH192_RS20200 (4168655) | 4168655..4170292 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
| PH192_RS20205 (4170380) | 4170380..4171678 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12158.08 Da Isoelectric Point: 8.4777
>T268526 WP_000254745.1 NZ_CP116241:4167230-4167565 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0XYM3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J1DJJ7 |