Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | itaRT/DUF1778(antitoxin) |
Location | 1872093..1872930 | Replicon | chromosome |
Accession | NZ_CP116241 | ||
Organism | Escherichia coli strain 7.1994/NIST0056 |
Toxin (Protein)
Gene name | itaT | Uniprot ID | Q3Z4X7 |
Locus tag | PH192_RS09225 | Protein ID | WP_000227784.1 |
Coordinates | 1872388..1872930 (+) | Length | 181 a.a. |
Antitoxin (Protein)
Gene name | itaR | Uniprot ID | I2UQS9 |
Locus tag | PH192_RS09220 | Protein ID | WP_001297137.1 |
Coordinates | 1872093..1872404 (+) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PH192_RS09195 (1867113) | 1867113..1868060 | + | 948 | WP_001239441.1 | cytochrome o ubiquinol oxidase subunit II | - |
PH192_RS09200 (1868082) | 1868082..1870073 | + | 1992 | WP_000467180.1 | cytochrome o ubiquinol oxidase subunit I | - |
PH192_RS09205 (1870063) | 1870063..1870677 | + | 615 | WP_000179819.1 | cytochrome o ubiquinol oxidase subunit III | - |
PH192_RS09210 (1870677) | 1870677..1871006 | + | 330 | WP_000019869.1 | cytochrome o ubiquinol oxidase subunit IV | - |
PH192_RS09215 (1871018) | 1871018..1871908 | + | 891 | WP_000971336.1 | heme o synthase | - |
PH192_RS09220 (1872093) | 1872093..1872404 | + | 312 | WP_001297137.1 | DUF1778 domain-containing protein | Antitoxin |
PH192_RS09225 (1872388) | 1872388..1872930 | + | 543 | WP_000227784.1 | GNAT family N-acetyltransferase | Toxin |
PH192_RS09230 (1872986) | 1872986..1873921 | - | 936 | WP_001297127.1 | tetratricopeptide repeat protein | - |
PH192_RS09235 (1874329) | 1874329..1875693 | + | 1365 | WP_001000978.1 | MFS transporter | - |
PH192_RS09240 (1875821) | 1875821..1876312 | - | 492 | WP_001138904.1 | nucleotide binding protein YajQ | - |
PH192_RS09245 (1876480) | 1876480..1877391 | + | 912 | WP_000705874.1 | 2-dehydropantoate 2-reductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 181 a.a. Molecular weight: 19805.02 Da Isoelectric Point: 8.3395
>T268510 WP_000227784.1 NZ_CP116241:1872388-1872930 [Escherichia coli]
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
MVDKHEEITLPIVLSCNYQSDITYPGQKQFDCGNPVIDKFVRASLKKSVRNSDCAAKALIDRQSGELIGICTFTAYSLEK
QRVSGVLQGSQPSEIGVVRLVMLGVARKYQKRGFGQDLLCDFFEHVKIIHQALPIKGVYLDADPAAINFYARLGFVQLSA
TPNAFGAVPMFLAIQHILAA
Download Length: 543 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|