Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1838017..1838635 | Replicon | chromosome |
Accession | NZ_CP116241 | ||
Organism | Escherichia coli strain 7.1994/NIST0056 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | PH192_RS09055 | Protein ID | WP_001291435.1 |
Coordinates | 1838417..1838635 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | PH192_RS09050 | Protein ID | WP_000344800.1 |
Coordinates | 1838017..1838391 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PH192_RS09040 (1833106) | 1833106..1834299 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
PH192_RS09045 (1834322) | 1834322..1837471 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
PH192_RS09050 (1838017) | 1838017..1838391 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
PH192_RS09055 (1838417) | 1838417..1838635 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
PH192_RS09060 (1838806) | 1838806..1839357 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
PH192_RS09065 (1839473) | 1839473..1839943 | + | 471 | WP_000136192.1 | YlaC family protein | - |
PH192_RS09070 (1840107) | 1840107..1841657 | + | 1551 | WP_001299455.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
PH192_RS09075 (1841699) | 1841699..1842052 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
PH192_RS09085 (1842431) | 1842431..1842742 | + | 312 | WP_000409911.1 | MGMT family protein | - |
PH192_RS09090 (1842773) | 1842773..1843345 | - | 573 | WP_271356475.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T268509 WP_001291435.1 NZ_CP116241:1838417-1838635 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT268509 WP_000344800.1 NZ_CP116241:1838017-1838391 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |