Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 756011..756649 | Replicon | chromosome |
| Accession | NZ_CP116241 | ||
| Organism | Escherichia coli strain 7.1994/NIST0056 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | PH192_RS03610 | Protein ID | WP_000813794.1 |
| Coordinates | 756473..756649 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PH192_RS03605 | Protein ID | WP_001270285.1 |
| Coordinates | 756011..756427 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PH192_RS03585 (751163) | 751163..752104 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
| PH192_RS03590 (752105) | 752105..753118 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| PH192_RS03595 (753136) | 753136..754281 | - | 1146 | WP_000047456.1 | ABC transporter substrate-binding protein | - |
| PH192_RS03600 (754526) | 754526..755932 | - | 1407 | WP_000760589.1 | PLP-dependent aminotransferase family protein | - |
| PH192_RS03605 (756011) | 756011..756427 | - | 417 | WP_001270285.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| PH192_RS03610 (756473) | 756473..756649 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| PH192_RS03615 (756871) | 756871..757101 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| PH192_RS03620 (757193) | 757193..759154 | - | 1962 | WP_001301045.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| PH192_RS03625 (759227) | 759227..759763 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| PH192_RS03630 (759855) | 759855..761030 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 761070..762218 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T268507 WP_000813794.1 NZ_CP116241:c756649-756473 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15247.61 Da Isoelectric Point: 4.6115
>AT268507 WP_001270285.1 NZ_CP116241:c756427-756011 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFDLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|