Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 5735619..5736244 | Replicon | chromosome |
Accession | NZ_CP116239 | ||
Organism | Pseudomonas sp. TUM22785 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | PI990_RS26085 | Protein ID | WP_184487482.1 |
Coordinates | 5736062..5736244 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | PI990_RS26080 | Protein ID | WP_184487483.1 |
Coordinates | 5735619..5736026 (-) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PI990_RS26070 (PI990_26070) | 5733449..5734456 | + | 1008 | WP_271658918.1 | nucleoid-associated protein YejK | - |
PI990_RS26075 (PI990_26075) | 5734515..5735450 | - | 936 | WP_021220875.1 | glutathione S-transferase family protein | - |
PI990_RS26080 (PI990_26080) | 5735619..5736026 | - | 408 | WP_184487483.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PI990_RS26085 (PI990_26085) | 5736062..5736244 | - | 183 | WP_184487482.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PI990_RS26090 (PI990_26090) | 5736398..5736697 | - | 300 | WP_271658919.1 | GIY-YIG nuclease family protein | - |
PI990_RS26095 (PI990_26095) | 5736694..5737392 | - | 699 | WP_271658920.1 | glutathione S-transferase family protein | - |
PI990_RS26100 (PI990_26100) | 5737483..5737953 | - | 471 | WP_271658921.1 | nuclear transport factor 2 family protein | - |
PI990_RS26105 (PI990_26105) | 5738072..5739022 | + | 951 | WP_271661357.1 | helix-turn-helix domain-containing protein | - |
PI990_RS26110 (PI990_26110) | 5739437..5740564 | + | 1128 | WP_265170506.1 | IS481 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6854.94 Da Isoelectric Point: 10.4779
>T268500 WP_184487482.1 NZ_CP116239:c5736244-5736062 [Pseudomonas sp. TUM22785]
MRSREVIEKIKEDGWYEVEVKGSHHQFKHPNKPGRVTVPHPKSDLPIGTVRSILKQAGLL
MRSREVIEKIKEDGWYEVEVKGSHHQFKHPNKPGRVTVPHPKSDLPIGTVRSILKQAGLL
Download Length: 183 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14439.26 Da Isoelectric Point: 4.3752
>AT268500 WP_184487483.1 NZ_CP116239:c5736026-5735619 [Pseudomonas sp. TUM22785]
MKFPLVLHKDPDSDYGVTVPDVPGCFSAGATVAEALENVKEALALHFEGLVADGEALPQAQQIDVHIGNPDFAGGVWAVV
EFDVTPYLGKAVRFNATLPENLLQRIDERVSKDARYASRSGFLATAALRELSDAG
MKFPLVLHKDPDSDYGVTVPDVPGCFSAGATVAEALENVKEALALHFEGLVADGEALPQAQQIDVHIGNPDFAGGVWAVV
EFDVTPYLGKAVRFNATLPENLLQRIDERVSKDARYASRSGFLATAALRELSDAG
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|