Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 2901894..2902573 | Replicon | chromosome |
| Accession | NZ_CP116239 | ||
| Organism | Pseudomonas sp. TUM22785 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | PI990_RS13435 | Protein ID | WP_031286782.1 |
| Coordinates | 2902388..2902573 (-) | Length | 62 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | PI990_RS13430 | Protein ID | WP_271660925.1 |
| Coordinates | 2901894..2902337 (-) | Length | 148 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PI990_RS13405 (PI990_13405) | 2897744..2898319 | + | 576 | WP_271660920.1 | hypothetical protein | - |
| PI990_RS13410 (PI990_13410) | 2898312..2898560 | + | 249 | WP_271660921.1 | hypothetical protein | - |
| PI990_RS13415 (PI990_13415) | 2898572..2899828 | + | 1257 | WP_271660922.1 | site-specific integrase | - |
| PI990_RS13420 (PI990_13420) | 2899934..2900263 | + | 330 | WP_271660923.1 | antiterminator Q family protein | - |
| PI990_RS13425 (PI990_13425) | 2900481..2901710 | - | 1230 | WP_271660924.1 | hypothetical protein | - |
| PI990_RS13430 (PI990_13430) | 2901894..2902337 | - | 444 | WP_271660925.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PI990_RS13435 (PI990_13435) | 2902388..2902573 | - | 186 | WP_031286782.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PI990_RS13440 (PI990_13440) | 2902700..2903020 | + | 321 | WP_184490333.1 | phage holin, lambda family | - |
| PI990_RS13445 (PI990_13445) | 2903022..2903357 | + | 336 | WP_271660926.1 | HNH endonuclease signature motif containing protein | - |
| PI990_RS13450 (PI990_13450) | 2903444..2903887 | + | 444 | WP_271660927.1 | terminase small subunit | - |
| PI990_RS13455 (PI990_13455) | 2903891..2905564 | + | 1674 | WP_271660928.1 | terminase large subunit | - |
| PI990_RS13460 (PI990_13460) | 2905561..2905737 | + | 177 | WP_213629624.1 | hypothetical protein | - |
| PI990_RS13465 (PI990_13465) | 2905740..2907008 | + | 1269 | WP_271660929.1 | phage portal protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2885650..2937956 | 52306 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6913.00 Da Isoelectric Point: 10.9941
>T268497 WP_031286782.1 NZ_CP116239:c2902573-2902388 [Pseudomonas sp. TUM22785]
MKHSEFRRWLRAQGVTFEAAKGSHFKITAPNGKTTIFADHGSKEMKEPTRKAIIKQLGLTE
MKHSEFRRWLRAQGVTFEAAKGSHFKITAPNGKTTIFADHGSKEMKEPTRKAIIKQLGLTE
Download Length: 186 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 15976.35 Da Isoelectric Point: 4.6364
>AT268497 WP_271660925.1 NZ_CP116239:c2902337-2901894 [Pseudomonas sp. TUM22785]
MFDYPIRLEADDTPGLAVFCRDLPELNSYGDDVAHALAEAVDAIESTLSLYVDQRRAIPAASPAQAGEHAVRLPAVTVAK
IYLWNAMMEQGLRKADLCRLLGVAPMQVDRLVDFLHTSKMEAVEAALAKLGKRLAVSVEAGEWPQSA
MFDYPIRLEADDTPGLAVFCRDLPELNSYGDDVAHALAEAVDAIESTLSLYVDQRRAIPAASPAQAGEHAVRLPAVTVAK
IYLWNAMMEQGLRKADLCRLLGVAPMQVDRLVDFLHTSKMEAVEAALAKLGKRLAVSVEAGEWPQSA
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|