Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 848314..848936 Replicon chromosome
Accession NZ_CP116239
Organism Pseudomonas sp. TUM22785

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag PI990_RS03980 Protein ID WP_271659879.1
Coordinates 848314..848496 (+) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag PI990_RS03985 Protein ID WP_271659880.1
Coordinates 848529..848936 (+) Length 136 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PI990_RS03960 (PI990_03960) 843475..845379 - 1905 WP_271659876.1 1-deoxy-D-xylulose-5-phosphate synthase -
PI990_RS03965 (PI990_03965) 845417..846634 - 1218 WP_271659877.1 MFS transporter -
PI990_RS03970 (PI990_03970) 846732..847181 + 450 WP_043245949.1 helix-turn-helix domain-containing protein -
PI990_RS03975 (PI990_03975) 847421..847870 - 450 WP_271659878.1 BRO family protein -
PI990_RS03980 (PI990_03980) 848314..848496 + 183 WP_271659879.1 type II toxin-antitoxin system HicA family toxin Toxin
PI990_RS03985 (PI990_03985) 848529..848936 + 408 WP_271659880.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
PI990_RS03990 (PI990_03990) 849046..849303 - 258 WP_271659881.1 DUF4332 domain-containing protein -
PI990_RS03995 (PI990_03995) 849320..849775 - 456 WP_271659882.1 RDD family protein -
PI990_RS04000 (PI990_04000) 850010..850792 - 783 WP_271659883.1 hypothetical protein -
PI990_RS04005 (PI990_04005) 850995..851726 + 732 WP_271659884.1 YafY family protein -
PI990_RS04010 (PI990_04010) 851762..852064 + 303 WP_271659885.1 antibiotic biosynthesis monooxygenase -
PI990_RS04015 (PI990_04015) 852142..852483 - 342 WP_021219689.1 zinc ribbon domain-containing protein YjdM -
PI990_RS04020 (PI990_04020) 852723..853427 + 705 WP_271659886.1 sulfotransferase family 2 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-128)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6686.86 Da        Isoelectric Point: 11.0668

>T268493 WP_271659879.1 NZ_CP116239:848314-848496 [Pseudomonas sp. TUM22785]
VNSRQLIELIEVDGWFLVRTRGSHHHFKHPSKPGLVTIPHPKKDLLAATVASILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 136 a.a.        Molecular weight: 14763.85 Da        Isoelectric Point: 4.4403

>AT268493 WP_271659880.1 NZ_CP116239:848529-848936 [Pseudomonas sp. TUM22785]
MLYPIAILPGDDAHAWGVEVPDLPGCFSAGDDLDEAMAMAREAIEGHLELLAEDGAPIPVARKVTFHAEDPRYAGCTWAL
VDIDVVRYMGKAEKLNITLPGYLLNRIDEYVRTHPEQKSRSGFLAAAAMRALQEA

Download         Length: 408 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References