Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 795309..795871 | Replicon | chromosome |
Accession | NZ_CP116239 | ||
Organism | Pseudomonas sp. TUM22785 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | - |
Locus tag | PI990_RS03725 | Protein ID | WP_271659853.1 |
Coordinates | 795554..795871 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | - |
Locus tag | PI990_RS03720 | Protein ID | WP_271659852.1 |
Coordinates | 795309..795554 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PI990_RS03700 (PI990_03700) | 791452..792657 | + | 1206 | WP_271659848.1 | precorrin-6y C5,15-methyltransferase (decarboxylating) subunit CbiE | - |
PI990_RS03705 (PI990_03705) | 792702..793799 | + | 1098 | WP_271659849.1 | cobalt-precorrin-5B (C(1))-methyltransferase | - |
PI990_RS03710 (PI990_03710) | 793796..794527 | + | 732 | WP_271659850.1 | cobalt-precorrin-6A reductase | - |
PI990_RS03715 (PI990_03715) | 794524..795231 | + | 708 | WP_271659851.1 | (2Fe-2S) ferredoxin domain-containing protein | - |
PI990_RS03720 (PI990_03720) | 795309..795554 | + | 246 | WP_271659852.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
PI990_RS03725 (PI990_03725) | 795554..795871 | + | 318 | WP_271659853.1 | CcdB family protein | Toxin |
PI990_RS03730 (PI990_03730) | 795882..797024 | - | 1143 | WP_271659854.1 | MFS transporter | - |
PI990_RS03735 (PI990_03735) | 797372..798004 | - | 633 | WP_271659855.1 | VWA domain-containing protein | - |
PI990_RS03740 (PI990_03740) | 798025..799029 | - | 1005 | WP_271659856.1 | AAA family ATPase | - |
PI990_RS03745 (PI990_03745) | 799552..800640 | + | 1089 | WP_271659857.1 | 3-deoxy-7-phosphoheptulonate synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11339.26 Da Isoelectric Point: 4.4685
>T268492 WP_271659853.1 NZ_CP116239:795554-795871 [Pseudomonas sp. TUM22785]
MPQFAVHLNTNPATRAKIPYLLDVQSDLIDGLATRLIVPLYIDDILDGRAVGTLMPKFEVEGTTVVMFTPELAGVPRNVL
GAQVADLSGHRFEIIAALDLLITGI
MPQFAVHLNTNPATRAKIPYLLDVQSDLIDGLATRLIVPLYIDDILDGRAVGTLMPKFEVEGTTVVMFTPELAGVPRNVL
GAQVADLSGHRFEIIAALDLLITGI
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|