Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PemK-MazE
Location 2325868..2326406 Replicon chromosome
Accession NZ_CP116236
Organism Gordonia polyisoprenivorans strain 135

Toxin (Protein)


Gene name mazF Uniprot ID A0A846WRB2
Locus tag PHA63_RS10300 Protein ID WP_006368698.1
Coordinates 2326074..2326406 (+) Length 111 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A846WSS4
Locus tag PHA63_RS10295 Protein ID WP_026920098.1
Coordinates 2325868..2326077 (+) Length 70 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PHA63_RS10260 (PHA63_10260) 2321330..2321914 + 585 WP_210739670.1 TetR family transcriptional regulator -
PHA63_RS10265 (PHA63_10265) 2322032..2322433 + 402 WP_240523935.1 hypothetical protein -
PHA63_RS10270 (PHA63_10270) 2322492..2322713 + 222 Protein_2034 HAD hydrolase-like protein -
PHA63_RS10275 (PHA63_10275) 2322847..2324115 + 1269 WP_006368693.1 APC family permease -
PHA63_RS10280 (PHA63_10280) 2324162..2324953 + 792 WP_006368694.1 ABC transporter permease -
PHA63_RS10285 (PHA63_10285) 2325051..2325230 + 180 WP_014362243.1 hypothetical protein -
PHA63_RS10290 (PHA63_10290) 2325370..2325711 + 342 WP_006368696.1 type II toxin-antitoxin system VapC family toxin -
PHA63_RS10295 (PHA63_10295) 2325868..2326077 + 210 WP_026920098.1 DUF3018 family protein Antitoxin
PHA63_RS10300 (PHA63_10300) 2326074..2326406 + 333 WP_006368698.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
PHA63_RS10305 (PHA63_10305) 2326697..2327830 + 1134 WP_271355511.1 tyrosine-type recombinase/integrase -
PHA63_RS10310 (PHA63_10310) 2327827..2328192 + 366 WP_271355512.1 helix-turn-helix transcriptional regulator -
PHA63_RS10315 (PHA63_10315) 2328494..2329633 + 1140 WP_271355513.1 Fis family transcriptional regulator -
PHA63_RS10320 (PHA63_10320) 2329844..2330533 + 690 WP_271355514.1 hypothetical protein -
PHA63_RS10325 (PHA63_10325) 2330703..2331143 + 441 WP_271355515.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(2-108)

Antitoxin

Antitoxin MazE-like

(4-67)


Sequences

Toxin        


Download         Length: 111 a.a.        Molecular weight: 12053.86 Da        Isoelectric Point: 7.0139

>T268491 WP_006368698.1 NZ_CP116236:2326074-2326406 [Gordonia polyisoprenivorans]
VIRGEIWTVAGGVYASKPRPAVIVQDDLFDSTLSVVVAPITSQLIDAPLLRIRIPGDRDSISGHERDSDVMVDKLTAVRR
SNVQTRVGRLTSDQLVEVERSLMAFLGLAR

Download         Length: 333 bp

Antitoxin


Download         Length: 70 a.a.        Molecular weight: 7925.79 Da        Isoelectric Point: 4.4550

>AT268491 WP_026920098.1 NZ_CP116236:2325868-2326077 [Gordonia polyisoprenivorans]
MAVRDRVGEYRRRMRERGMRPLQVWVPDVRTPEFAAQAHRQSVLVAEADADGDEQDFVEAVAAPWDDEA

Download         Length: 210 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A846WRB2

Antitoxin

Source ID Structure
AlphaFold DB A0A846WSS4

References