Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/YafQ(toxin) |
Location | 582339..582963 | Replicon | chromosome |
Accession | NZ_CP116234 | ||
Organism | Helicobacter pylori strain H390d |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | PHA49_RS02785 | Protein ID | WP_271331027.1 |
Coordinates | 582697..582963 (+) | Length | 89 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | PHA49_RS02780 | Protein ID | WP_271331026.1 |
Coordinates | 582339..582716 (+) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PHA49_RS02755 (PHA49_02755) | 577525..578637 | + | 1113 | WP_271331023.1 | hydrogenase formation protein HypD | - |
PHA49_RS02760 (PHA49_02760) | 578588..579214 | - | 627 | WP_271331024.1 | helicase DnaB modulator | - |
PHA49_RS02775 (PHA49_02775) | 579625..581850 | + | 2226 | WP_271331025.1 | Hop family adhesin BabA | - |
PHA49_RS02780 (PHA49_02780) | 582339..582716 | + | 378 | WP_271331026.1 | hypothetical protein | Antitoxin |
PHA49_RS02785 (PHA49_02785) | 582697..582963 | + | 267 | WP_271331027.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
PHA49_RS02790 (PHA49_02790) | 583042..583353 | + | 312 | WP_180669626.1 | type II toxin-antitoxin system antitoxin | - |
PHA49_RS02795 (PHA49_02795) | 583340..583612 | + | 273 | WP_271331028.1 | type II toxin-antitoxin system YafQ family toxin | - |
PHA49_RS02800 (PHA49_02800) | 583718..584242 | - | 525 | WP_001120212.1 | acyl-CoA thioesterase | - |
PHA49_RS02805 (PHA49_02805) | 584385..585227 | + | 843 | WP_271331029.1 | SDR family oxidoreductase | - |
PHA49_RS02810 (PHA49_02810) | 585220..586200 | + | 981 | WP_000921438.1 | iron ABC transporter permease | - |
PHA49_RS02815 (PHA49_02815) | 586200..586967 | + | 768 | WP_024422093.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10235.10 Da Isoelectric Point: 9.9517
>T268487 WP_271331027.1 NZ_CP116234:582697-582963 [Helicobacter pylori]
VLKLNLKKSFQKDFDKLLLNGFDDSVLNKVILSLRKKEPLGSQFQDHALKGKWKPFRECHIKADILLVYLVKDDELILVR
LGSHSELF
VLKLNLKKSFQKDFDKLLLNGFDDSVLNKVILSLRKKEPLGSQFQDHALKGKWKPFRECHIKADILLVYLVKDDELILVR
LGSHSELF
Download Length: 267 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 14699.62 Da Isoelectric Point: 7.8469
>AT268487 WP_271331026.1 NZ_CP116234:582339-582716 [Helicobacter pylori]
MPNSPTKKDYTQYSEKQLFNLIHQLEQKIKRMQNDRASFKEKMAKELEKRDQNFKDKIDALNELLQKISQAFDNKRDCCL
GHKIPNIETQQAMRDALNKETDLIVDDFSSYSDERKKALGVETQS
MPNSPTKKDYTQYSEKQLFNLIHQLEQKIKRMQNDRASFKEKMAKELEKRDQNFKDKIDALNELLQKISQAFDNKRDCCL
GHKIPNIETQQAMRDALNKETDLIVDDFSSYSDERKKALGVETQS
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|