Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higB-toxA/Tad-HTH_37 |
Location | 2424978..2425623 | Replicon | chromosome |
Accession | NZ_CP116231 | ||
Organism | Fusobacterium nucleatum strain JD-Fn1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PGW91_RS11540 | Protein ID | WP_271333211.1 |
Coordinates | 2424978..2425346 (+) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | toxA | Uniprot ID | - |
Locus tag | PGW91_RS11545 | Protein ID | WP_029492811.1 |
Coordinates | 2425336..2425623 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PGW91_RS11525 (PGW91_11525) | 2421659..2423968 | + | 2310 | WP_271333208.1 | AAA family ATPase | - |
PGW91_RS11530 (PGW91_11530) | 2424063..2424200 | + | 138 | WP_271333209.1 | hypothetical protein | - |
PGW91_RS11535 (PGW91_11535) | 2424401..2424862 | + | 462 | WP_271333210.1 | hypothetical protein | - |
PGW91_RS11540 (PGW91_11540) | 2424978..2425346 | + | 369 | WP_271333211.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PGW91_RS11545 (PGW91_11545) | 2425336..2425623 | + | 288 | WP_029492811.1 | helix-turn-helix domain-containing protein | Antitoxin |
PGW91_RS11550 (PGW91_11550) | 2425646..2425966 | + | 321 | WP_271333212.1 | nucleotidyltransferase domain-containing protein | - |
PGW91_RS11555 (PGW91_11555) | 2426031..2426249 | + | 219 | WP_271333213.1 | DUF6290 family protein | - |
PGW91_RS11560 (PGW91_11560) | 2426289..2426831 | - | 543 | WP_032847252.1 | hypothetical protein | - |
PGW91_RS11565 (PGW91_11565) | 2426858..2427364 | - | 507 | WP_271333214.1 | HAD family hydrolase | - |
PGW91_RS11570 (PGW91_11570) | 2427374..2427946 | - | 573 | WP_032833974.1 | crossover junction endodeoxyribonuclease RuvC | - |
PGW91_RS11575 (PGW91_11575) | 2427946..2428698 | - | 753 | WP_032847258.1 | MgtC/SapB family protein | - |
PGW91_RS11580 (PGW91_11580) | 2428818..2429570 | - | 753 | WP_032847260.1 | SDR family oxidoreductase | - |
PGW91_RS11585 (PGW91_11585) | 2429754..2430407 | + | 654 | WP_238983103.1 | Crp/Fnr family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 14752.33 Da Isoelectric Point: 10.4222
>T268485 WP_271333211.1 NZ_CP116231:2424978-2425346 [Fusobacterium nucleatum]
MYKVGFYLKNGKSDIIEYLDKLKIKSEKSKEARIIRNKILSYIKSLELYGTRVGEPIVKHIEDNIWELRPLNNRIFFFYF
KDNKFILLHYFIKKTNKTPKKEIEEAKNRMNDFIARSDKNVK
MYKVGFYLKNGKSDIIEYLDKLKIKSEKSKEARIIRNKILSYIKSLELYGTRVGEPIVKHIEDNIWELRPLNNRIFFFYF
KDNKFILLHYFIKKTNKTPKKEIEEAKNRMNDFIARSDKNVK
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|