Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VapB |
| Location | 451896..452467 | Replicon | chromosome |
| Accession | NZ_CP116224 | ||
| Organism | Actinomyces oris strain WVU627 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | PGE45_RS01920 | Protein ID | WP_271288857.1 |
| Coordinates | 451896..452273 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | F2UXK9 |
| Locus tag | PGE45_RS01925 | Protein ID | WP_003787711.1 |
| Coordinates | 452270..452467 (-) | Length | 66 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PGE45_RS01905 (PGE45_01905) | 448039..449280 | + | 1242 | WP_271288854.1 | hypothetical protein | - |
| PGE45_RS01910 (PGE45_01910) | 449617..451119 | + | 1503 | WP_271288855.1 | hypothetical protein | - |
| PGE45_RS01915 (PGE45_01915) | 451218..451814 | - | 597 | WP_271288856.1 | hypothetical protein | - |
| PGE45_RS01920 (PGE45_01920) | 451896..452273 | - | 378 | WP_271288857.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PGE45_RS01925 (PGE45_01925) | 452270..452467 | - | 198 | WP_003787711.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PGE45_RS01930 (PGE45_01930) | 452723..455035 | - | 2313 | WP_271288858.1 | hypothetical protein | - |
| PGE45_RS01935 (PGE45_01935) | 455495..456823 | + | 1329 | WP_271288859.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13801.86 Da Isoelectric Point: 6.3263
>T268479 WP_271288857.1 NZ_CP116224:c452273-451896 [Actinomyces oris]
VILVDTSVWIDHFHHSDPVLVSLLHEDEIGSHPLVAEELAMGSLRSRDDVLKHLAHLRQFPVLSHDELLALVAAHALWGR
GLSPVDAHLLGSVMLVPGARLWTRDKRLLRAAEERGVSFTEGTAC
VILVDTSVWIDHFHHSDPVLVSLLHEDEIGSHPLVAEELAMGSLRSRDDVLKHLAHLRQFPVLSHDELLALVAAHALWGR
GLSPVDAHLLGSVMLVPGARLWTRDKRLLRAAEERGVSFTEGTAC
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|