Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 3663325..3663974 | Replicon | chromosome |
| Accession | NZ_CP116223 | ||
| Organism | Proteus mirabilis strain PM1-chromosome | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | B4EZB9 |
| Locus tag | PG663_RS16960 | Protein ID | WP_012368534.1 |
| Coordinates | 3663325..3663744 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B4EZC0 |
| Locus tag | PG663_RS16965 | Protein ID | WP_012368535.1 |
| Coordinates | 3663741..3663974 (-) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PG663_RS16930 (PG663_16930) | 3658604..3659482 | - | 879 | WP_004246812.1 | 23S rRNA pseudouridine(2604) synthase RluF | - |
| PG663_RS16935 (PG663_16935) | 3659658..3660572 | - | 915 | WP_004249085.1 | fatty acid biosynthesis protein FabY | - |
| PG663_RS16940 (PG663_16940) | 3660596..3661033 | - | 438 | WP_004246810.1 | D-aminoacyl-tRNA deacylase | - |
| PG663_RS16945 (PG663_16945) | 3661113..3661730 | - | 618 | WP_020946398.1 | glucose-1-phosphatase | - |
| PG663_RS16950 (PG663_16950) | 3662383..3662799 | - | 417 | WP_046334846.1 | hypothetical protein | - |
| PG663_RS16955 (PG663_16955) | 3662777..3663055 | - | 279 | WP_230629709.1 | hypothetical protein | - |
| PG663_RS16960 (PG663_16960) | 3663325..3663744 | - | 420 | WP_012368534.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PG663_RS16965 (PG663_16965) | 3663741..3663974 | - | 234 | WP_012368535.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PG663_RS16970 (PG663_16970) | 3664724..3666559 | - | 1836 | WP_004246802.1 | ribosome-dependent GTPase TypA | - |
| PG663_RS16975 (PG663_16975) | 3666919..3668328 | + | 1410 | WP_004246801.1 | glutamate--ammonia ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15371.88 Da Isoelectric Point: 7.7288
>T268477 WP_012368534.1 NZ_CP116223:c3663744-3663325 [Proteus mirabilis]
VKKVYMLDTNICSFIMREQPISLLEKLQKCVMNHDTIVISAITYSEMRFGAIGKKASPKHNRLVDAFCERVDAILAWDKA
AVDATTVIKKCLSDVGLPIGNNDSAIAGHAVAVNAILVTNNTREFSRVEGLKIEDWTHV
VKKVYMLDTNICSFIMREQPISLLEKLQKCVMNHDTIVISAITYSEMRFGAIGKKASPKHNRLVDAFCERVDAILAWDKA
AVDATTVIKKCLSDVGLPIGNNDSAIAGHAVAVNAILVTNNTREFSRVEGLKIEDWTHV
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|