Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/RelE-MqsA |
Location | 3642757..3643456 | Replicon | chromosome |
Accession | NZ_CP116223 | ||
Organism | Proteus mirabilis strain PM1-chromosome |
Toxin (Protein)
Gene name | relE | Uniprot ID | B4EZ96 |
Locus tag | PG663_RS16855 | Protein ID | WP_004249093.1 |
Coordinates | 3642757..3643143 (+) | Length | 129 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | B4EZ97 |
Locus tag | PG663_RS16860 | Protein ID | WP_004246828.1 |
Coordinates | 3643136..3643456 (+) | Length | 107 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PG663_RS16840 (PG663_16840) | 3638776..3639357 | - | 582 | WP_004246833.1 | DNA-3-methyladenine glycosylase I | - |
PG663_RS16845 (PG663_16845) | 3639608..3640513 | + | 906 | WP_004246832.1 | glycine--tRNA ligase subunit alpha | - |
PG663_RS16850 (PG663_16850) | 3640523..3642595 | + | 2073 | WP_060554931.1 | glycine--tRNA ligase subunit beta | - |
PG663_RS16855 (PG663_16855) | 3642757..3643143 | + | 387 | WP_004249093.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PG663_RS16860 (PG663_16860) | 3643136..3643456 | + | 321 | WP_004246828.1 | helix-turn-helix domain-containing protein | Antitoxin |
PG663_RS16865 (PG663_16865) | 3643505..3643939 | - | 435 | WP_004246827.1 | hypothetical protein | - |
PG663_RS16870 (PG663_16870) | 3643932..3644816 | - | 885 | WP_012368526.1 | endonuclease/exonuclease/phosphatase family protein | - |
PG663_RS16875 (PG663_16875) | 3645034..3646320 | - | 1287 | WP_060554932.1 | DUF3748 domain-containing protein | - |
PG663_RS16880 (PG663_16880) | 3646457..3647074 | + | 618 | WP_004246822.1 | trimeric intracellular cation channel family protein | - |
PG663_RS16885 (PG663_16885) | 3647376..3647999 | + | 624 | WP_004246821.1 | guanylate kinase | - |
PG663_RS16890 (PG663_16890) | 3648054..3648329 | + | 276 | WP_004246820.1 | DNA-directed RNA polymerase subunit omega | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 129 a.a. Molecular weight: 14294.64 Da Isoelectric Point: 10.0642
>T268476 WP_004249093.1 NZ_CP116223:3642757-3643143 [Proteus mirabilis]
MVIYKTKMFKNSFKKITLTNAELIAIATEVLAGQFEADLGGGVIKKRACIQGKGKSSGIRTIIFYKQGNNLFFADGWKKS
SLSSKKTKEITDDELESYKDLAKDLFNANQNKIDKMIALGLLTEVKYD
MVIYKTKMFKNSFKKITLTNAELIAIATEVLAGQFEADLGGGVIKKRACIQGKGKSSGIRTIIFYKQGNNLFFADGWKKS
SLSSKKTKEITDDELESYKDLAKDLFNANQNKIDKMIALGLLTEVKYD
Download Length: 387 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|