Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 14604..15205 Replicon chromosome
Accession NZ_CP116223
Organism Proteus mirabilis strain PM1-chromosome

Toxin (Protein)


Gene name doc Uniprot ID A0A2X2BIG8
Locus tag PG663_RS00065 Protein ID WP_004246497.1
Coordinates 14604..14987 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID A0A1Z1SPN9
Locus tag PG663_RS00070 Protein ID WP_004246496.1
Coordinates 14984..15205 (-) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PG663_RS00040 (PG663_00040) 9975..10433 + 459 WP_004249766.1 GNAT family N-acetyltransferase -
PG663_RS00045 (PG663_00045) 10529..11266 - 738 WP_275258766.1 tetratricopeptide repeat protein -
PG663_RS00050 (PG663_00050) 11375..12274 + 900 WP_017628715.1 N-acetylmuramic acid 6-phosphate etherase -
PG663_RS00055 (PG663_00055) 12631..13869 - 1239 WP_004246499.1 HipA domain-containing protein -
PG663_RS00060 (PG663_00060) 13882..14196 - 315 WP_004246498.1 helix-turn-helix transcriptional regulator -
PG663_RS00065 (PG663_00065) 14604..14987 - 384 WP_004246497.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PG663_RS00070 (PG663_00070) 14984..15205 - 222 WP_004246496.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PG663_RS00075 (PG663_00075) 15486..16349 - 864 WP_004249947.1 YicC/YloC family endoribonuclease -
PG663_RS00080 (PG663_00080) 16476..17192 + 717 WP_275258768.1 ribonuclease PH -
PG663_RS00085 (PG663_00085) 17274..17918 + 645 WP_004246493.1 orotate phosphoribosyltransferase -
PG663_RS00090 (PG663_00090) 18238..18843 - 606 WP_004246491.1 nucleoid occlusion factor SlmA -
PG663_RS00095 (PG663_00095) 18963..19421 - 459 WP_004246490.1 dUTP diphosphatase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(5-115)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-52)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14471.53 Da        Isoelectric Point: 8.5125

>T268472 WP_004246497.1 NZ_CP116223:c14987-14604 [Proteus mirabilis]
MIWVSAQEVIAFHDRILQRFPGVAGMSDPGRAEALIYRVQNRKHYEGITDVFELAATYWVAIARGHIFNDGNKRTAFFVT
MTFLYRNGIRIRDTGNMLENLTVEAATGEKTVDQLAKHLQNLVEKTN

Download         Length: 384 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8260.23 Da        Isoelectric Point: 5.5667

>AT268472 WP_004246496.1 NZ_CP116223:c15205-14984 [Proteus mirabilis]
MRTYTSTQARANISEVLDIATHGEPVEITRRDGCSAVVISKTEFESYQNAKLDAEFDMMMQRHGHTVEALTNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2X2BIG8

Antitoxin

Source ID Structure
AlphaFold DB A0A1Z1SPN9

References