Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1527507..1528164 | Replicon | chromosome |
Accession | NZ_CP116222 | ||
Organism | Providencia vermicola strain PVA41-chromosome |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | PG365_RS06600 | Protein ID | WP_163860914.1 |
Coordinates | 1527754..1528164 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | PG365_RS06595 | Protein ID | WP_154624313.1 |
Coordinates | 1527507..1527773 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PG365_RS06580 (PG365_06580) | 1522659..1525535 | + | 2877 | WP_251463864.1 | aminomethyl-transferring glycine dehydrogenase | - |
PG365_RS06585 (PG365_06585) | 1525632..1526252 | - | 621 | WP_154624315.1 | HD domain-containing protein | - |
PG365_RS06590 (PG365_06590) | 1526264..1527253 | - | 990 | WP_154624314.1 | tRNA-modifying protein YgfZ | - |
PG365_RS06595 (PG365_06595) | 1527507..1527773 | + | 267 | WP_154624313.1 | FAD assembly factor SdhE | Antitoxin |
PG365_RS06600 (PG365_06600) | 1527754..1528164 | + | 411 | WP_163860914.1 | protein YgfX | Toxin |
PG365_RS06605 (PG365_06605) | 1528209..1528727 | - | 519 | WP_154624312.1 | flavodoxin FldB | - |
PG365_RS06610 (PG365_06610) | 1528812..1529735 | + | 924 | WP_154624329.1 | site-specific tyrosine recombinase XerD | - |
PG365_RS06615 (PG365_06615) | 1529755..1530456 | + | 702 | WP_154624311.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
PG365_RS06620 (PG365_06620) | 1530466..1532199 | + | 1734 | WP_196713356.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15375.24 Da Isoelectric Point: 10.8779
>T268469 WP_163860914.1 NZ_CP116222:1527754-1528164 [Providencia vermicola]
VVLWKSNLSISWKTQLFSTCAHGLVGFILLVAPWAPGNSMVWLPLLAIVIASWAKSQKSISKIKGTAVLVNGNKVQWKKN
EWNIIKQPWCSRVGILLTLSALQGKQQKIRLWIAKDALSEESWRNLNQLLLQYPDI
VVLWKSNLSISWKTQLFSTCAHGLVGFILLVAPWAPGNSMVWLPLLAIVIASWAKSQKSISKIKGTAVLVNGNKVQWKKN
EWNIIKQPWCSRVGILLTLSALQGKQQKIRLWIAKDALSEESWRNLNQLLLQYPDI
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|