Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 877546..878196 | Replicon | chromosome |
| Accession | NZ_CP116222 | ||
| Organism | Providencia vermicola strain PVA41-chromosome | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | K8W3H1 |
| Locus tag | PG365_RS03750 | Protein ID | WP_004927064.1 |
| Coordinates | 877546..877749 (-) | Length | 68 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | PG365_RS03755 | Protein ID | WP_154635730.1 |
| Coordinates | 877828..878196 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PG365_RS03725 (PG365_03725) | 873426..873764 | + | 339 | WP_154622397.1 | P-II family nitrogen regulator | - |
| PG365_RS03730 (PG365_03730) | 873775..875058 | + | 1284 | WP_251465118.1 | ammonium transporter AmtB | - |
| PG365_RS03735 (PG365_03735) | 875286..876152 | - | 867 | WP_251465121.1 | acyl-CoA thioesterase II | - |
| PG365_RS03740 (PG365_03740) | 876477..876935 | + | 459 | WP_251465123.1 | YbaY family lipoprotein | - |
| PG365_RS03750 (PG365_03750) | 877546..877749 | - | 204 | WP_004927064.1 | HHA domain-containing protein | Toxin |
| PG365_RS03755 (PG365_03755) | 877828..878196 | - | 369 | WP_154635730.1 | Hha toxicity modulator TomB | Antitoxin |
| PG365_RS03760 (PG365_03760) | 878764..880101 | - | 1338 | WP_154624041.1 | murein transglycosylase D | - |
| PG365_RS03765 (PG365_03765) | 880180..880935 | - | 756 | WP_154624042.1 | hydroxyacylglutathione hydrolase | - |
| PG365_RS03770 (PG365_03770) | 880975..881700 | + | 726 | WP_154624043.1 | methyltransferase domain-containing protein | - |
| PG365_RS03775 (PG365_03775) | 881767..882237 | - | 471 | WP_154624044.1 | ribonuclease HI | - |
| PG365_RS03780 (PG365_03780) | 882292..883053 | + | 762 | WP_154624045.1 | DNA polymerase III subunit epsilon | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 68 a.a. Molecular weight: 8075.37 Da Isoelectric Point: 6.9770
>T268468 WP_004927064.1 NZ_CP116222:c877749-877546 [Providencia vermicola]
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSEDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
MTKTDYLMRLRKCTTIDTLERVIEKNKYELSEDELELFYSAADHRLAELTMNKLYDKIPASVWKFVR
Download Length: 204 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 14106.92 Da Isoelectric Point: 4.3486
>AT268468 WP_154635730.1 NZ_CP116222:c878196-877828 [Providencia vermicola]
MDEYSPKNYDISELKYLCNSLNREAISSLQKTNTHWINDLSSPQSVRLNELIEHIAAFVWQYKIKHPKDNLVISLVEEYL
DETYDLFGSPVITLSEIIDWQSMNQNLVAVLDDDLKCPASKT
MDEYSPKNYDISELKYLCNSLNREAISSLQKTNTHWINDLSSPQSVRLNELIEHIAAFVWQYKIKHPKDNLVISLVEEYL
DETYDLFGSPVITLSEIIDWQSMNQNLVAVLDDDLKCPASKT
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|