Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 6166..6809 Replicon plasmid p2562_3
Accession NZ_CP116217
Organism Klebsiella michiganensis strain 2563

Toxin (Protein)


Gene name vagD Uniprot ID A0A5P6KDG5
Locus tag PHA56_RS31030 Protein ID WP_021312768.1
Coordinates 6393..6809 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID A0A5P6KGW8
Locus tag PHA56_RS31025 Protein ID WP_021312767.1
Coordinates 6166..6396 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PHA56_RS30995 (PHA56_30995) 1471..2097 + 627 WP_016946792.1 ParA family plasmid-partitioning AAA ATPase -
PHA56_RS31000 (PHA56_31000) 2094..2396 + 303 WP_004197636.1 hypothetical protein -
PHA56_RS31005 (PHA56_31005) 2812..3606 - 795 WP_016240356.1 site-specific integrase -
PHA56_RS31010 (PHA56_31010) 3804..4819 - 1016 Protein_4 hypothetical protein -
PHA56_RS31015 (PHA56_31015) 5013..5318 - 306 WP_006788214.1 type II toxin-antitoxin system toxin CcdB -
PHA56_RS31020 (PHA56_31020) 5320..5538 - 219 WP_006788213.1 type II toxin-antitoxin system antitoxin CcdA -
PHA56_RS31025 (PHA56_31025) 6166..6396 + 231 WP_021312767.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PHA56_RS31030 (PHA56_31030) 6393..6809 + 417 WP_021312768.1 type II toxin-antitoxin system VapC family toxin Toxin
PHA56_RS31035 (PHA56_31035) 6997..7701 - 705 WP_001067855.1 IS6-like element IS26 family transposase -
PHA56_RS31040 (PHA56_31040) 7766..10540 + 2775 Protein_10 Tn3 family transposase -
PHA56_RS31045 (PHA56_31045) 10748..11716 - 969 WP_077255425.1 IS5-like element IS903B family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..105902 105902


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-50)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15175.60 Da        Isoelectric Point: 7.2452

>T268467 WP_021312768.1 NZ_CP116217:6393-6809 [Klebsiella michiganensis]
VNKIYMLDTNICSFIMREQPEAVLKRLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPDLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8722.81 Da        Isoelectric Point: 4.4692

>AT268467 WP_021312767.1 NZ_CP116217:6166-6396 [Klebsiella michiganensis]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQLEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5P6KDG5

Antitoxin

Source ID Structure
AlphaFold DB A0A5P6KGW8

References