Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 5013..5538 | Replicon | plasmid p2562_3 |
Accession | NZ_CP116217 | ||
Organism | Klebsiella michiganensis strain 2563 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | A0A1D8K3Q5 |
Locus tag | PHA56_RS31015 | Protein ID | WP_006788214.1 |
Coordinates | 5013..5318 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | A0A1D8K3R4 |
Locus tag | PHA56_RS31020 | Protein ID | WP_006788213.1 |
Coordinates | 5320..5538 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PHA56_RS30990 (PHA56_30990) | 19..894 | + | 876 | WP_004098982.1 | replication initiation protein | - |
PHA56_RS30995 (PHA56_30995) | 1471..2097 | + | 627 | WP_016946792.1 | ParA family plasmid-partitioning AAA ATPase | - |
PHA56_RS31000 (PHA56_31000) | 2094..2396 | + | 303 | WP_004197636.1 | hypothetical protein | - |
PHA56_RS31005 (PHA56_31005) | 2812..3606 | - | 795 | WP_016240356.1 | site-specific integrase | - |
PHA56_RS31010 (PHA56_31010) | 3804..4819 | - | 1016 | Protein_4 | hypothetical protein | - |
PHA56_RS31015 (PHA56_31015) | 5013..5318 | - | 306 | WP_006788214.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
PHA56_RS31020 (PHA56_31020) | 5320..5538 | - | 219 | WP_006788213.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
PHA56_RS31025 (PHA56_31025) | 6166..6396 | + | 231 | WP_021312767.1 | type II toxin-antitoxin system VapB family antitoxin | - |
PHA56_RS31030 (PHA56_31030) | 6393..6809 | + | 417 | WP_021312768.1 | type II toxin-antitoxin system VapC family toxin | - |
PHA56_RS31035 (PHA56_31035) | 6997..7701 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..105902 | 105902 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11687.46 Da Isoelectric Point: 7.2015
>T268466 WP_006788214.1 NZ_CP116217:c5318-5013 [Klebsiella michiganensis]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRLMTTDMASVPASVTGEEV
ADLRHRENDIKNAINLMFWGI
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRLMTTDMASVPASVTGEEV
ADLRHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1D8K3Q5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1D8K3R4 |