Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 176420..176955 | Replicon | plasmid p2562_2 |
| Accession | NZ_CP116216 | ||
| Organism | Klebsiella michiganensis strain 2563 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A6M4NRI2 |
| Locus tag | PHA56_RS30965 | Protein ID | WP_032693963.1 |
| Coordinates | 176668..176955 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A8G2A2B7 |
| Locus tag | PHA56_RS30960 | Protein ID | WP_032752108.1 |
| Coordinates | 176420..176671 (+) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA56_RS30930 (PHA56_30930) | 171789..172068 | - | 280 | Protein_185 | hypothetical protein | - |
| PHA56_RS30935 (PHA56_30935) | 172386..172616 | - | 231 | WP_047665741.1 | hypothetical protein | - |
| PHA56_RS30940 (PHA56_30940) | 172680..173351 | - | 672 | WP_032700854.1 | plasmid partitioning/stability family protein | - |
| PHA56_RS30945 (PHA56_30945) | 173354..174325 | - | 972 | WP_077255421.1 | plasmid segregation protein ParM | - |
| PHA56_RS30950 (PHA56_30950) | 174544..174987 | + | 444 | WP_040118420.1 | translesion error-prone DNA polymerase V autoproteolytic subunit | - |
| PHA56_RS30955 (PHA56_30955) | 174987..176255 | + | 1269 | WP_032752101.1 | Y-family DNA polymerase | - |
| PHA56_RS30960 (PHA56_30960) | 176420..176671 | + | 252 | WP_032752108.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| PHA56_RS30965 (PHA56_30965) | 176668..176955 | + | 288 | WP_032693963.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PHA56_RS30970 (PHA56_30970) | 177555..178756 | + | 1202 | WP_096913407.1 | IS3 family transposase | - |
| PHA56_RS30975 (PHA56_30975) | 179383..179655 | + | 273 | Protein_194 | DNA polymerase V subunit UmuC | - |
| PHA56_RS30980 (PHA56_30980) | 180321..181292 | - | 972 | WP_032752114.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..183276 | 183276 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11133.12 Da Isoelectric Point: 10.2246
>T268465 WP_032693963.1 NZ_CP116216:176668-176955 [Klebsiella michiganensis]
MTYTVKFREDALKEWQKLDKAIQQQFAKKLKKCCDEPHIPSAKLRGIKDCYKIKLRASGFRLVYQVIDDQLIIAVVAVGK
RERSDVYNLASERMR
MTYTVKFREDALKEWQKLDKAIQQQFAKKLKKCCDEPHIPSAKLRGIKDCYKIKLRASGFRLVYQVIDDQLIIAVVAVGK
RERSDVYNLASERMR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|