Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 54858..55594 | Replicon | plasmid p2562_2 |
| Accession | NZ_CP116216 | ||
| Organism | Klebsiella michiganensis strain 2563 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | L7SZ15 |
| Locus tag | PHA56_RS30305 | Protein ID | WP_003026803.1 |
| Coordinates | 54858..55340 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | L7SZ29 |
| Locus tag | PHA56_RS30310 | Protein ID | WP_003026799.1 |
| Coordinates | 55328..55594 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA56_RS30275 (PHA56_30275) | 51471..52760 | + | 1290 | WP_000922630.1 | arsenite efflux transporter membrane subunit ArsB | - |
| PHA56_RS30280 (PHA56_30280) | 52773..53198 | + | 426 | WP_000065758.1 | glutaredoxin-dependent arsenate reductase | - |
| PHA56_RS30285 (PHA56_30285) | 53229..53495 | - | 267 | WP_102047566.1 | ArsA-related P-loop ATPase | - |
| PHA56_RS30290 (PHA56_30290) | 53569..54273 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| PHA56_RS30295 (PHA56_30295) | 54328..54450 | + | 123 | Protein_58 | IS3 family transposase | - |
| PHA56_RS30300 (PHA56_30300) | 54472..54699 | + | 228 | Protein_59 | IS3 family transposase | - |
| PHA56_RS30305 (PHA56_30305) | 54858..55340 | - | 483 | WP_003026803.1 | GNAT family N-acetyltransferase | Toxin |
| PHA56_RS30310 (PHA56_30310) | 55328..55594 | - | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
| PHA56_RS30315 (PHA56_30315) | 55864..56652 | + | 789 | WP_077255422.1 | hypothetical protein | - |
| PHA56_RS30320 (PHA56_30320) | 56598..57302 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| PHA56_RS30325 (PHA56_30325) | 57366..60151 | + | 2786 | Protein_64 | Tn3 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..183276 | 183276 | |
| - | inside | IScluster/Tn | - | - | 53569..71396 | 17827 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17353.97 Da Isoelectric Point: 9.5822
>T268464 WP_003026803.1 NZ_CP116216:c55340-54858 [Klebsiella michiganensis]
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITTPEPLSSSHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2GNW6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1Q8YL66 |