Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | kacAT/ElaA-DUF1778 |
| Location | 227707..228510 | Replicon | plasmid p2562_1 |
| Accession | NZ_CP116215 | ||
| Organism | Klebsiella michiganensis strain 2563 | ||
Toxin (Protein)
| Gene name | KacT | Uniprot ID | A0A8B2S6X5 |
| Locus tag | PHA56_RS29320 | Protein ID | WP_048213819.1 |
| Coordinates | 227980..228510 (+) | Length | 177 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | A0A8B2S700 |
| Locus tag | PHA56_RS29315 | Protein ID | WP_048213818.1 |
| Coordinates | 227707..227976 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PHA56_RS29290 (PHA56_29290) | 222937..223284 | - | 348 | WP_000624622.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| PHA56_RS29295 (PHA56_29295) | 223284..223961 | - | 678 | WP_106904188.1 | IS66-like element accessory protein TnpA | - |
| PHA56_RS29300 (PHA56_29300) | 224048..224733 | + | 686 | Protein_238 | IS3 family transposase | - |
| PHA56_RS29305 (PHA56_29305) | 225406..226914 | + | 1509 | WP_001189109.1 | group II intron reverse transcriptase/maturase | - |
| PHA56_RS29310 (PHA56_29310) | 226995..227492 | + | 498 | Protein_240 | IS3 family transposase | - |
| PHA56_RS29315 (PHA56_29315) | 227707..227976 | + | 270 | WP_048213818.1 | DUF1778 domain-containing protein | Antitoxin |
| PHA56_RS29320 (PHA56_29320) | 227980..228510 | + | 531 | WP_048213819.1 | GNAT family N-acetyltransferase | Toxin |
| PHA56_RS29325 (PHA56_29325) | 228595..229599 | - | 1005 | WP_048213820.1 | hypothetical protein | - |
| PHA56_RS29330 (PHA56_29330) | 229604..229849 | - | 246 | WP_048213821.1 | hypothetical protein | - |
| PHA56_RS29335 (PHA56_29335) | 230608..231975 | - | 1368 | WP_230324193.1 | adenylate/guanylate cyclase domain-containing protein | - |
| PHA56_RS29340 (PHA56_29340) | 231985..232518 | - | 534 | WP_048213822.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | formA | - | 1..362448 | 362448 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 177 a.a. Molecular weight: 20322.17 Da Isoelectric Point: 6.7544
>T268462 WP_048213819.1 NZ_CP116215:227980-228510 [Klebsiella michiganensis]
MDGLRIEIFSEEVEYELSNFDCGEEYLNTFLTDHLKRQHNSKILRGYLLVTREDKPRVMGYYTLSGSCFEKTLLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENSNSL
FYPTKSVEELFEVKDE
MDGLRIEIFSEEVEYELSNFDCGEEYLNTFLTDHLKRQHNSKILRGYLLVTREDKPRVMGYYTLSGSCFEKTLLPSKTQQ
KRVPYKNVPSVTLGRLAIDKSIHHQGYGETLVTHAMKVVYQASQAVGIHGMFVEALNDNAKKFYLRLGFIQLKEENSNSL
FYPTKSVEELFEVKDE
Download Length: 531 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B2S6X5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B2S700 |