Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 63567..64093 | Replicon | plasmid p2562_1 |
Accession | NZ_CP116215 | ||
Organism | Klebsiella michiganensis strain 2563 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | PHA56_RS28445 | Protein ID | WP_000323025.1 |
Coordinates | 63806..64093 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | J5W3H0 |
Locus tag | PHA56_RS28440 | Protein ID | WP_004196370.1 |
Coordinates | 63567..63806 (+) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PHA56_RS28405 (PHA56_28405) | 58904..59096 | - | 193 | Protein_59 | MFS transporter | - |
PHA56_RS28410 (PHA56_28410) | 59126..60103 | + | 978 | WP_004196334.1 | chromate resistance protein | - |
PHA56_RS28415 (PHA56_28415) | 60060..61436 | + | 1377 | WP_004196363.1 | chromate efflux transporter | - |
PHA56_RS28420 (PHA56_28420) | 61467..62156 | - | 690 | WP_004196322.1 | hypothetical protein | - |
PHA56_RS28425 (PHA56_28425) | 62170..62907 | - | 738 | WP_008460272.1 | HupE/UreJ family protein | - |
PHA56_RS28430 (PHA56_28430) | 62951..63316 | - | 366 | WP_009651956.1 | hypothetical protein | - |
PHA56_RS28435 (PHA56_28435) | 63444..63542 | - | 99 | Protein_65 | protein YdfV | - |
PHA56_RS28440 (PHA56_28440) | 63567..63806 | + | 240 | WP_004196370.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
PHA56_RS28445 (PHA56_28445) | 63806..64093 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
PHA56_RS28450 (PHA56_28450) | 64165..64323 | + | 159 | WP_004181898.1 | type I toxin-antitoxin system Hok family toxin | - |
PHA56_RS28455 (PHA56_28455) | 64929..65903 | + | 975 | WP_004196336.1 | hypothetical protein | - |
PHA56_RS28460 (PHA56_28460) | 65887..66009 | + | 123 | WP_254911979.1 | hypothetical protein | - |
PHA56_RS28465 (PHA56_28465) | 66101..66478 | - | 378 | WP_045289277.1 | hypothetical protein | - |
PHA56_RS28470 (PHA56_28470) | 66805..67101 | + | 297 | WP_094313394.1 | hydrogenase expression/formation protein HypD | - |
PHA56_RS28475 (PHA56_28475) | 67170..68237 | + | 1068 | WP_049130554.1 | hypothetical protein | - |
PHA56_RS28480 (PHA56_28480) | 68393..68740 | + | 348 | WP_042935949.1 | hypothetical protein | - |
PHA56_RS28485 (PHA56_28485) | 68819..69052 | + | 234 | WP_042935952.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | formA | - | 1..362448 | 362448 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T268461 WP_000323025.1 NZ_CP116215:63806-64093 [Klebsiella michiganensis]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|