Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 5245831..5246407 | Replicon | chromosome |
Accession | NZ_CP116214 | ||
Organism | Klebsiella michiganensis strain 2563 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | A0A1D8JNH2 |
Locus tag | PHA56_RS24795 | Protein ID | WP_042933975.1 |
Coordinates | 5246120..5246407 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | - |
Locus tag | PHA56_RS24790 | Protein ID | WP_014837314.1 |
Coordinates | 5245831..5246133 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PHA56_RS24775 (PHA56_24775) | 5242668..5243003 | + | 336 | WP_032719937.1 | endoribonuclease SymE | - |
PHA56_RS24780 (PHA56_24780) | 5243458..5244369 | + | 912 | WP_119834584.1 | acetamidase/formamidase family protein | - |
PHA56_RS24785 (PHA56_24785) | 5244366..5245709 | + | 1344 | WP_119834583.1 | APC family permease | - |
PHA56_RS24790 (PHA56_24790) | 5245831..5246133 | - | 303 | WP_014837314.1 | BrnA antitoxin family protein | Antitoxin |
PHA56_RS24795 (PHA56_24795) | 5246120..5246407 | - | 288 | WP_042933975.1 | BrnT family toxin | Toxin |
PHA56_RS24800 (PHA56_24800) | 5246657..5247100 | - | 444 | WP_014837312.1 | FosA family fosfomycin resistance glutathione transferase | - |
PHA56_RS24805 (PHA56_24805) | 5247094..5248002 | - | 909 | WP_119834582.1 | LysR family transcriptional regulator | - |
PHA56_RS24810 (PHA56_24810) | 5248090..5248872 | + | 783 | WP_032693033.1 | NAD(P)H-dependent oxidoreductase | - |
PHA56_RS24815 (PHA56_24815) | 5249020..5249604 | + | 585 | WP_004098242.1 | TetR/AcrR family transcriptional regulator | - |
PHA56_RS24820 (PHA56_24820) | 5249750..5250550 | + | 801 | WP_014227752.1 | winged helix-turn-helix domain-containing protein | - |
PHA56_RS24825 (PHA56_24825) | 5250547..5251065 | + | 519 | WP_042944214.1 | FidL-like protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11239.69 Da Isoelectric Point: 8.5899
>T268460 WP_042933975.1 NZ_CP116214:c5246407-5246120 [Klebsiella michiganensis]
MPMEFEWDANKARSNLRKHGIRFEEAVLVFDDPRHLSRQDRYENGEYRWQTIGLVHGVIVIMVAHSVRFESGTEVIRIIS
ARKADSKERNRYEHG
MPMEFEWDANKARSNLRKHGIRFEEAVLVFDDPRHLSRQDRYENGEYRWQTIGLVHGVIVIMVAHSVRFESGTEVIRIIS
ARKADSKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|