Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX(toxin) |
Location | 4753655..4754474 | Replicon | chromosome |
Accession | NZ_CP116214 | ||
Organism | Klebsiella michiganensis strain 2563 |
Toxin (Protein)
Gene name | yjhX | Uniprot ID | J5WT09 |
Locus tag | PHA56_RS22475 | Protein ID | WP_004110819.1 |
Coordinates | 4754217..4754474 (-) | Length | 86 a.a. |
Antitoxin (Protein)
Gene name | yjhQ | Uniprot ID | - |
Locus tag | PHA56_RS22470 | Protein ID | WP_047684097.1 |
Coordinates | 4753655..4754206 (-) | Length | 184 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PHA56_RS22440 (PHA56_22440) | 4749579..4750352 | + | 774 | WP_103433587.1 | Zygote formation protein zyg1 | - |
PHA56_RS22445 (PHA56_22445) | 4750663..4751136 | + | 474 | WP_032693194.1 | hypothetical protein | - |
PHA56_RS22450 (PHA56_22450) | 4751405..4751754 | - | 350 | Protein_4417 | type II toxin-antitoxin system VapC family toxin | - |
PHA56_RS22455 (PHA56_22455) | 4751817..4751975 | - | 159 | Protein_4418 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
PHA56_RS22460 (PHA56_22460) | 4752009..4752755 | - | 747 | WP_223226754.1 | class I SAM-dependent methyltransferase | - |
PHA56_RS22465 (PHA56_22465) | 4753179..4753541 | - | 363 | Protein_4420 | class I SAM-dependent methyltransferase | - |
PHA56_RS22470 (PHA56_22470) | 4753655..4754206 | - | 552 | WP_047684097.1 | N-acetyltransferase | Antitoxin |
PHA56_RS22475 (PHA56_22475) | 4754217..4754474 | - | 258 | WP_004110819.1 | YjhX family toxin | Toxin |
PHA56_RS22480 (PHA56_22480) | 4755150..4756334 | + | 1185 | WP_014228054.1 | mannonate dehydratase | - |
PHA56_RS22485 (PHA56_22485) | 4756408..4757883 | + | 1476 | WP_119834689.1 | fructuronate reductase | - |
PHA56_RS22490 (PHA56_22490) | 4758022..4758798 | + | 777 | WP_004847986.1 | Uxu operon transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9552.07 Da Isoelectric Point: 11.1381
>T268459 WP_004110819.1 NZ_CP116214:c4754474-4754217 [Klebsiella michiganensis]
MNLSRQEQRTLHVLAKGGRIAHIRDASGRVTSVECYSREGLLLSDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
MNLSRQEQRTLHVLAKGGRIAHIRDASGRVTSVECYSREGLLLSDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 184 a.a. Molecular weight: 19842.60 Da Isoelectric Point: 6.4897
>AT268459 WP_047684097.1 NZ_CP116214:c4754206-4753655 [Klebsiella michiganensis]
MTNHSFTFHVASEGDTDDILDVETRAFGYSKEARLVADLLNDESACPTLSLLARHNGEAVGHILFTRATFKGEPDSPMMH
ILAPLAVVPEYQGAGVGGELIRHGIEQLKAMGSQAVFVLGHAACYPRHGFEPGAGDKGYPAPYPIPAAHKACWMLQPISS
QPLGRTGQIQCARALMKPEHWRE
MTNHSFTFHVASEGDTDDILDVETRAFGYSKEARLVADLLNDESACPTLSLLARHNGEAVGHILFTRATFKGEPDSPMMH
ILAPLAVVPEYQGAGVGGELIRHGIEQLKAMGSQAVFVLGHAACYPRHGFEPGAGDKGYPAPYPIPAAHKACWMLQPISS
QPLGRTGQIQCARALMKPEHWRE
Download Length: 552 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|